SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|72432|estExt_fgeneshTM_pm.C_150056 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|72432|estExt_fgeneshTM_pm.C_150056
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.24e-36
Family Nip7p homolog, N-terminal domain 0.0000448
Further Details:      
 
Domain Number 2 Region: 99-172
Classification Level Classification E-value
Superfamily PUA domain-like 3.48e-22
Family PUA domain 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|72432|estExt_fgeneshTM_pm.C_150056
Sequence length 182
Sequence
MRPLSEDETKAVFEKLANYIGKNLVHLIDRPEDDAHVFRLHKDRVYYLPLPMLHYATSIA
RPNLVSLGTCMGKFSKTGKFKLGVTSLDWLARYAKHKLIWIKPAGELPFLYGNHIVKAHL
GRITEDTPEHQGVVVYNMADVPLGFGVTARSTLDTRKLDPSGIIVFHQADVGEFLRDEDT
MF
Download sequence
Identical sequences R7SDQ3
XP_007007865.1.33187 jgi|Treme1|72432|estExt_fgeneshTM_pm.C_150056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]