SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|73748|estExt_fgeneshTM_pg.C_40442 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|73748|estExt_fgeneshTM_pg.C_40442
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.51e-38
Family Calponin-homology domain, CH-domain 0.0000294
Further Details:      
 
Domain Number 2 Region: 161-229
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000353
Family EB1 dimerisation domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|73748|estExt_fgeneshTM_pg.C_40442
Sequence length 245
Sequence
MSIYVGESRGELLAWLNDLLAPPQPITKVEQCGTGAIYCQVMDSIFGNLPMTKVKFNARQ
EYEHLENFKILQKCFTINKIDKPIPVDKLIKCKMQDNLEFLQWMKKFWDANAPGGGYDAL
GRTGGAAITSGPSSRAPANRAPPRTSASTAARSVSSTSNAQLQALTAQVQEMQLHCEGLE
KERDFYFDKLRQIEVSVTKRLEQPDVCDEERDHLAGVQAVLYATQEGFEVPDPEGLTLED
DEETF
Download sequence
Identical sequences XP_007004377.1.33187 jgi|Treme1|73748|estExt_fgeneshTM_pg.C_40442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]