SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|74178|estExt_fgeneshTM_pg.C_70301 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|74178|estExt_fgeneshTM_pg.C_70301
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily EF-hand 4.33e-45
Family Calmodulin-like 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|74178|estExt_fgeneshTM_pg.C_70301
Sequence length 175
Sequence
MGQAESTVYHSLEKNSNFSGPELLRLKKRFMKLDKDGSGSIDKDEFLQIPQIANNPLAHR
MIAIFDEDGSGTVDFQEFVGGLSAFSSKGGREEKLRFAFKVYDMDRDGFISNGELYLVLK
QMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFAAMVENTDIVKQMTLEDLF
Download sequence
Identical sequences XP_007005596.1.33187 jgi|Treme1|74178|estExt_fgeneshTM_pg.C_70301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]