SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|74205|estExt_fgeneshTM_pg.C_80044 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|74205|estExt_fgeneshTM_pg.C_80044
Domain Number 1 Region: 533-630
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-23
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-19
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 266-335
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.86e-17
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|74205|estExt_fgeneshTM_pg.C_80044
Domain Number - Region: 748-850
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000667
Family Calponin-homology domain, CH-domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|74205|estExt_fgeneshTM_pg.C_80044
Sequence length 858
Sequence
MLVVEAVHNFRAEHDDELSFLAGDKIVVMEKDDAFGDGWWRGRNEKGEEGLFPATYVSED
HPNDIDHVKTDNDGTSIPLPHSPTPPAVNIETSVVPLPQPQTAKGNLTDGPLQTVTTSVE
AVTTGVSNVVGKTIVDIQDVIESMVKPESDDDQEVGIGQNTRARLAAQARIANEHRERQR
VSGGITGLVYSDESEDDDDDRPLGPQVIFPTAEPAPSPNGVRQDSPNPPTPASTQLNGQD
PPRGLQPSLPLPATPPPEKISGGTPTRPPNTWSVEEVVNWIRSKGFDEAICEKFHEHEIS
GDLLLELDANLLKELDIPQFGKRLRIAQAIAELQRPSSLVSASSQQMSPNGMPLPPSSNP
SYRGMSAPPTALAQPFMTHSPPAQFSEDGYSAWSHTRKPSMTPSTMPPPMEAISESATFA
SPHSSMPANGTSTAASSLPASPITPNSATVKRESTGSMGHKKGKVSVDKPDRLSFFGRSR
KPAPPTTPGMEQRSSSRLGFGSGGNRVHHVQPATPEQLRKPSSGLGSAAALKQIGTPDHS
GYMKKKGETYGGWKTRFFVLKGAHLYYMKSEHEDRVKGHIDLRGHRVIVDENTHPGSYGF
RLIGGDKPHFFSSSEQTAIRQWMKALMKATIARDYSVPVTSSCNIPTIPLAQAQAMSPRP
PSPATRDATQRATRRENVNQLTAHDASVLMSLDTSSGQRRRASQTLTVTPTRPTRDMRRS
SGDLRRVSGGQVQQNVISVHVNDPIQMELIKWVNSQLPPQSPKAQNIPESFINGEIIFHL
TQHLTGIEPNPPVPSDAFNLDIDGHPGIPGLFAMMDMLIDSGIDTAGVSINDVRSGDVPA
ITRLLESIQRFSEMKQTV
Download sequence
Identical sequences XP_007005889.1.33187 jgi|Treme1|74205|estExt_fgeneshTM_pg.C_80044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]