SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|41792|estExt_Genewise1Plus.C_10962 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|41792|estExt_Genewise1Plus.C_10962
Domain Number 1 Region: 350-637
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.02e-70
Family Mitochondrial carrier 0.00016
Further Details:      
 
Domain Number 2 Region: 72-144,177-249
Classification Level Classification E-value
Superfamily EF-hand 1.12e-24
Family Calmodulin-like 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Treme1|41792|estExt_Genewise1Plus.C_10962
Domain Number - Region: 218-305
Classification Level Classification E-value
Superfamily EF-hand 0.042
Family Calmodulin-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|41792|estExt_Genewise1Plus.C_10962
Sequence length 702
Sequence
MSTASATDVDIGARVKSTIRTTADTLYTSVKPAENELARWRRTFEGCAKEEVEGKKYLNP
TQFIDAIAPTDEGFNRIKREQYAVLFRVADVSKRGLVSFEDFVVFETLLKRPDADYQLAF
SVFDVDASGSIDFDEFKNVLQANLATSGIPFDFDCDWMKLYLGKRGGRHVVAYQEFTQLM
KGFQGERLRQAFHYFDKDDDGYIAPDEFQRIIIEVAGHKLSDSVLERLPTLCLMNQGRKI
SYSEVFAFHNIIREMDAVERVIQHAIRKSKDGRISVSDFLDQAANTMRYGIFTPLEVNII
WHFASRGAATGSSDQRLTLADFEALLDAKWQPPALTSTPETSKSEHFIHDVLEPIYDFAQ
GGVAGGLGAYAVYPIDLVKTRLQNQRSTVVGEVLYRNAFDCVKKVYTNEGGVRAFYRGVM
PQLVGVAPEKAIKITMNNIVRQRATDPETGAISLPWEIMAGGTAGACQVVVTNPLEIVKI
RLQMAGEITRAEGSGAVPRGAVHVIRQLGLVGLYKGATACLCRDVPFSMIYFTAYAHLKK
DVFHEGRRGKVLSFGELLISAGVAGMPAAYFTTPADVVKTRLQSQARAGQTVYKGVVDGF
SKILTEEGPKALFKGGIARIIRSSPQFSVTLTAFELLNKYFPYPFANQPVPTRPTRQPTD
ISRIRARNALRILLDCSSGFGMVDQKAAAKGVQQYLPKSLGM
Download sequence
Identical sequences jgi|Treme1|41792|estExt_Genewise1Plus.C_10962 XP_007000952.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]