SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|70354|fgeneshTM_pm.18_#_8 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|70354|fgeneshTM_pm.18_#_8
Domain Number 1 Region: 31-763
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.12e-246
Family Motor proteins 0.0000000000262
Further Details:      
 
Domain Number 2 Region: 1057-1147
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-22
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|70354|fgeneshTM_pm.18_#_8
Sequence length 1247
Sequence
MAPSKKAGRKLGGLLGHGGGDATASTRTAKVQKADWSEGFKKKRQAGVPDMTLLSTITNE
AINDNLKQRFQNQEIYTYIAHVLISVNPFRDLGIYTDETLQSYRNKNRLEVPPHVFAVAE
SAYYRMTTEKENQCVIISGESGAGKTEAAKRIMQYIAAVSGGDSGQGGIEGIKEMVLATN
PLLESFGCAKTLRNDNSSRHGKYLEIMFNGLGMPVGAQITNYLLEKGRVVGQIRDERDFH
IFYQFTKGATPQQRDAFGLQGPEAYAYISRSGCLDVRSIDDVADFQETLRAMQVIGLSSE
EQNSIFKVLATILWLGNVEFVEDKDGNAAISDTGVTDFVAYLMECDAAQVQKVLLKRTVE
TQRGGRRGSVYEVPQNIAQATSGRDALAKALYNNLFEWIVSRVNVSMKPQGTTDYVIGVL
DIYGFEIFQDNSFEQLCINYVNEKLQQIFIELTLKAEQEEYVREQIKWTPIKFFDNAVVC
DLIEGRRPAGIFATLNDATATAHADPSAADNSFMQRSNLLSANPNFESRGNKFLIKHYAG
DVLYNVPGMTDKNKDTLVKDILDLIEGSKDRFLHTLFPEKVDHDSKKRPPTAGDKIRQSA
NDLVTNLMKCQPHYIRTIKPNQNRSPSEYDDKAILHQIKYLGLQENIRVRRAGFAYRAEF
GKMIQRFYLLSPATSYAGDYIWQGDDRSGCEQILKDAGIAKDEWQMGVTKAFIKTPETLF
FLEGERDKYWHNMARRIQRAWRAYVRRKEEAAIKIQRFWRNQKESLVYARKRDYGHEILA
GRKERRRFSLLGMRKFMGDYLDVGGRSAQGELLRNAAGLSPAETVYFSSRAELLVSKLGR
SSKLSPRFLVITDKAVYLIVNIAKDGRVSTTLERKIPLVTIRSVAMTNLRDDFIVLNIPP
CEEGDPVMTCSFKTEMTSVILTLTGGSTPVNIGPNIDYAKKREKRALIKAQKDETITRDG
VYKSHTILVGSGENPNSLSNPLPPRKPRVKVSKPAVSNVVNRAMNKPAARVLPGATKPAP
PPVLGATSNGPVKGLTKPGGSKTTAAAVTRGPPPPPPPPPPSQVTGPQKEMYKVLYNFAG
QEGEMNLTKGEEVEVKEKDDNGWWMVVKGGSEGWAPSNYLKLIESAPPPPPPPVARRPPP
SAPLAPAIPVIHKASTQNGGPSSFSTSSANSSRPVSGIGKPPAPAPAIKPKPAIPVKPGK
PPVPSATKITPAPGGVRGGGFQPPKAATGQLDLAAALAKRAQRAQEE
Download sequence
Identical sequences R7S988
jgi|Treme1|70354|fgeneshTM_pm.18_#_8 XP_007008155.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]