SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383776851|ref|YP_005461417.1| from Actinoplanes missouriensis 431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383776851|ref|YP_005461417.1|
Domain Number 1 Region: 83-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000102
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383776851|ref|YP_005461417.1|
Sequence length 149
Comment hypothetical protein AMIS_16810 [Actinoplanes missouriensis 431]
Sequence
MEAVLWIVLAIALVIGEAFTATILIIFFAAGAGAAALAAALGAPLLAQVIVFAVVSGLSV
AAVRPIVMRHARPSIETGDTPFGVEAIVGSHGVVVDEVDTSRGMIKIDGELWQARSFDGT
ETFQPGDRVTVVKLRGATVLVWHDDLPDV
Download sequence
Identical sequences I0H1L4
gi|383776851|ref|YP_005461417.1| WP_014441798.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]