SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383778958|ref|YP_005463524.1| from Actinoplanes missouriensis 431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383778958|ref|YP_005463524.1|
Domain Number 1 Region: 32-527
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 5.1e-201
Family Heme-dependent catalases 0.0000000000423
Further Details:      
 
Domain Number 2 Region: 549-686
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000000354
Family Catalase, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383778958|ref|YP_005463524.1|
Sequence length 699
Comment putative catalase [Actinoplanes missouriensis 431]
Sequence
MPEPTLPSPAALDPADSTPLKASLAPERGLQTGEYLTSGQGVRLPDTDHSLKAGTRGPTL
MEDFHLREKITHFDHERIPERVVHARGTGAYGVFTAYGNAASITRAGFLAEKNKQTEVFV
RFSTVLGSRGSADTVRDTRGFATKFYTDEGNFDLVGNNMPVFFIQDGIKFPDLIHAAKWH
PDREIPQAQTAHDTFWDFVSLHTEATHHVMWAMSDRAIPRSYRTMEGFGVHTFRLVNAAG
ETALVKFHWKPVAGVHSLAWEEAQIAAGVDPDFHRRDLTDSIDAGLFFEYELGVQVMPDT
PDETFQGIDLLDPTKIVPEELAPVQPIGKLVLNRNTDNFHAETEQIAFHMGNLVPGIEVT
NDPLLQARLFSYLDTQLSRLGGPNFNQLPINRPHAPVNDNLRDGMHQSVVHRGIAPYLPT
SLGNGAAPEATPPDKGAYVHLPKPVKGEKIRENPASYADHYSQAALFYHSLSPVEQEHMV
EAFTFELGKCYETPIRERMLTVLAKVDAGLTAKVAAGLGLPAPQDTTPAEVVPSPALAQV
TDRVWPITGRIVGVIAGPGADLDGIDSLRTAMKAHGVVLRVIAPIGGILDGKEIVERTFQ
TARSVEFDAIVIAGGAGKLVDLQATVLLQEAFRHAKAIGAWGDGEQLLLTAGIDPAAPGI
LRSADAGKAYAEQLAAALGKHRAWERMPLLKPAASSQGS
Download sequence
Identical sequences I0H7M1
gi|383778958|ref|YP_005463524.1| WP_014443902.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]