SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383782785|ref|YP_005467352.1| from Actinoplanes missouriensis 431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383782785|ref|YP_005467352.1|
Domain Number 1 Region: 6-308
Classification Level Classification E-value
Superfamily Phase 1 flagellin 8.24e-52
Family Phase 1 flagellin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383782785|ref|YP_005467352.1|
Sequence length 308
Comment putative flagellar hook-associated protein [Actinoplanes missouriensis 431]
Sequence
MSSSPRVTESSVRTRTMASLQRNLSRTQTAQDQISSGKQLHRPSDSPTGTVTALQLRSEV
RAQKKYSTNADDAMGRLGTVQDTLQDATVLVAKVRELTLAASSAGGGSTPEANKARAAEI
EQIKGTLIQYANTKYMDRPVFGGATPGNAAYGSTGGYTGEADGEVLRTIGPNAKVRVDVR
GPEVFGAETLPGSTDPNPAQLFNVLQGLTDAMRDGDSAGITAGLKNLDKASEILNSTLSE
VGARYNRVTQMKQSAEDRLMSVSSQLSDIEDVDLPKAIMELQLQQTSYQAALAATAKVIQ
PSLIDFLR
Download sequence
Identical sequences I0HIJ9
WP_014447719.1.27 gi|383782785|ref|YP_005467352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]