SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386845325|ref|YP_006263338.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386845325|ref|YP_006263338.1|
Domain Number 1 Region: 32-95
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000000567
Family Heme-dependent catalases 0.023
Further Details:      
 
Weak hits

Sequence:  gi|386845325|ref|YP_006263338.1|
Domain Number - Region: 169-222
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0719
Family Heme-dependent catalases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386845325|ref|YP_006263338.1|
Sequence length 240
Comment hypothetical protein ACPL_373 [Actinoplanes sp. SE50/110]
Sequence
MTPPDPGSPPVMRLLTAAVVIGLGVRVVRSRHRRFLHPAGRSFAGTLEIWGGAEPLGATL
LDTPAVHDVTVRVSKGAGTRGARVDIRGVAVRVGPADLLLSSTGRTALTKRLPVPRLSFD
TVYGAITPYRTGTRKLYLEAVPDPDARPLGRALSSIPAGAALLLRADDRTVGRVALRHAL
PEATDAALAFDPIRNATPDLHPTGLIHGSRALAYRLSQRWRGATPPATDPAALARTVTHH
Download sequence
Identical sequences G8S7Y2
WP_014687349.1.1565 WP_014687349.1.34629 gi|386845325|ref|YP_006263338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]