SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386846221|ref|YP_006264234.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386846221|ref|YP_006264234.1|
Domain Number 1 Region: 194-304
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.28e-24
Family NlpC/P60 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|386846221|ref|YP_006264234.1|
Domain Number - Region: 18-78
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386846221|ref|YP_006264234.1|
Sequence length 315
Comment D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase cwlS [Actinoplanes sp. SE50/110]
Sequence
MVALTALAITTSGATAAHAAPSKDELKKQIEAASNKLDDVTEAYNKTRIDLKATQTDAAK
LTASLKPAEAAKNQAVTKVNAIAASSYMTGRVGPMTLILGGNQHDLLERLSYLDQLSKSN
QAQIDNYTEVSRTYTSRQAELKATEQKQALQLKELDAQKAKYTKDLQKLTATQKELYGKP
TQSSGSWTGPIPKGSGDAGVAVAFAYKQIGKPYGFGDEGPNSYDCSGLTKAAWAAAGHSL
PHSASEQRYASGVTYIKAGTAGFVPKQGDLVFYRDGGHVALYVGSGMVIDAPHGGADVTR
RTINIMPVQGYGRIS
Download sequence
Identical sequences WP_014688239.1.1565 WP_014688239.1.34629 gi|386846221|ref|YP_006264234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]