SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386847896|ref|YP_006265909.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386847896|ref|YP_006265909.1|
Domain Number 1 Region: 198-472
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.23e-36
Family ROK 0.00047
Further Details:      
 
Domain Number 2 Region: 23-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000564
Family ROK associated domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|386847896|ref|YP_006265909.1|
Domain Number - Region: 94-207
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0667
Family Phase 1 flagellin 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386847896|ref|YP_006265909.1|
Sequence length 476
Comment N-acetyl-D-glucosamine kinase [Actinoplanes sp. SE50/110]
Sequence
MREAVGAPAPAGRPGRGRRPGARESILDAIRACEPLSRVELAKITGLTEAAVSMTVRRLL
EEGLVVETGRTPTGGKPRTLLQLDPTARLAVGVHLDEDTTTYVLTGQTGGVISRLARPAL
PAMSATRTGSTTGTSAGPAPAPTADQPVTAAPGSTASGSAAPGSTTSGPATAGPATTGSV
TASGDGDRLGDGVDLLLRTLAADIDTLLAGSGVDPARCLGVGIVWPGPHSGGPADDPLPH
LRGLGGDELGSRLSAATGWPVLVENDATAAAVGEYWVARVGPEQAFAALYMGGGIGAGIV
VEGRAMRGSHASAGEFGHLCLDVFGPECWCGSRGCLEVLAGPRTVVSAARDNRVAAAEAG
LDLSQPLRSVATEFAAIARAARAGAPHCRTLLETSARYVAAAAETVVNLLDIDLLVLTGP
GFAAASAIYGPAIMRRLAPADARTWHRNVTVTVSLAAATASATGAAALVLQSHLRA
Download sequence
Identical sequences G8S8F6
gi|386847896|ref|YP_006265909.1| WP_014689913.1.1565 WP_014689913.1.34629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]