SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386848089|ref|YP_006266102.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386848089|ref|YP_006266102.1|
Domain Number 1 Region: 69-583
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.41e-203
Family Heme-dependent catalases 0.000000000058
Further Details:      
 
Domain Number 2 Region: 592-743
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000000366
Family Catalase, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386848089|ref|YP_006266102.1|
Sequence length 748
Comment catalase [Actinoplanes sp. SE50/110]
Sequence
MEARSPAEVIKDAVTAVTSEKKPDVPGAPGSGTPTVEEPATPREPLPPKPEQGQPDTRTP
TGAPTGAPPTAYGQQGPYLTTAQGARLRDTDHSLKAGPRGPILLQDHHFREKITHFDHER
IPERVVHARGAGAHGVFTSYGTAAALTQAGFLKEKGKQTDVFVRFSTVLGSRGSADTVRD
TRGFATKFYTDEGTFDLVGNNMPVFFIQDAIKFPDIVHAAKWHPDREIPQAQSAHDTFWD
FVSLHTEAQHHTMWNMSDRGIPRSYRTMEGFGVHTFRLVNDAGETVLVKFHWKPKLGVHS
LVWEEAQITNGVDPDFHRRDLYDSIEAGAYPEWELGLQVFPDNPEETFAGIDLLDPTKIV
PEELAPVQPVGKLVLNRTPTNFHAEVEQVAFHLGNLVPGIDVTNDPLLQGRLFSYLDTQL
TRLAGPNFHQIPINAPHAPVNDMLRDGFHQHAVHAGVAPYRPNSLDGGNPFTTTEGSFVD
VPVVVTEAPKIRDLPVSFKDHYTQVRLFWQSMTPVEREHIIRAYTFELGKCYHQAIKERQ
LQCLANIDPVLCEQVALGLGLPAPAPSIDLPEVTPSAALSQIGQQWPADGRIVGIVVDET
GGDAAVAEIREAIAAAGMVPLIIAPHGGKVGGLTVQRTFATARSIEYDAVLVAAAPVPAP
DAVPARDEKAGAPRTAAVDPRVNMLVDEAWRHAKAIGGWGTGADLLRRTGLADTPGVVVG
DSATEVLTALQQLMANHRVWERFPATVA
Download sequence
Identical sequences G8SD24
gi|386848089|ref|YP_006266102.1| WP_014690106.1.1565 WP_014690106.1.34629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]