SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386849063|ref|YP_006267076.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386849063|ref|YP_006267076.1|
Domain Number - Region: 7-46
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0366
Family Achaeal helicase C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386849063|ref|YP_006267076.1|
Sequence length 76
Comment hypothetical protein ACPL_4113 [Actinoplanes sp. SE50/110]
Sequence
MRDDRQATETTETDARSTLLDLVARVPFGVQAAVLAGVLVAGVGVADTGRTEARAAEVVT
AFGIASTTCCPPPDPR
Download sequence
Identical sequences G8S6X9
WP_014691080.1.1565 WP_014691080.1.34629 gi|386849063|ref|YP_006267076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]