SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386852832|ref|YP_006270845.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386852832|ref|YP_006270845.1|
Domain Number 1 Region: 1-396
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.01e-88
Family Phase 1 flagellin 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386852832|ref|YP_006270845.1|
Sequence length 396
Comment Flagellin A [Actinoplanes sp. SE50/110]
Sequence
MGLRINQNIAAQNAYRNLSVTDNQMQKSLEKLSSGFRINRAADDAAGLSISEGLRAQTGG
LKVATRNAQDAISVVQTAEGALNETTSMLQRMRDLSVQASNASLDSDAKQAAQDEFSQLS
SEIDRVSTTTAFGKSKLLDGSFGNTNHLVTTTPAVMPAGGTAMTLSIDTVGGTTLNTPIA
ASFTTAATGTASTPQDVADNINTQLQTALKANGRDPNEISVTAKADETGKVTFEVNSSST
FNVTASNLVTAGASQTNASAASGDFQIGANSGEKLGVHINEVSSKSLGLNNLNLTTAAVG
TTPSGASQAIDAVDKAIKSVSATRAQLGAHQNRFEHTINNLNVAVENLSASESRIRDTDM
AQEMVSFTRNQILTQAGTSMLSQANQSAQNVLSLLR
Download sequence
Identical sequences G8S7L7
WP_014694834.1.1565 WP_014694834.1.34629 gi|386852832|ref|YP_006270845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]