SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386848589|ref|YP_006266602.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386848589|ref|YP_006266602.1|
Domain Number 1 Region: 524-668,701-752
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000000122
Family Tricorn protease N-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|386848589|ref|YP_006266602.1|
Domain Number - Region: 879-970,1177-1244
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0017
Family Tricorn protease N-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 29-101
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0112
Family ESAT-6 like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386848589|ref|YP_006266602.1|
Sequence length 1677
Comment RhsC-like protein [Actinoplanes sp. SE50/110]
Sequence
MPRPSDWWVLDLDADPTPGEPANLVTTGNRLLDFADDAHRAQRAVDSLQGDGAVLTWIGQ
SGDAFREQFGELPAQLRKVYDSHRMAGDALHAFAPRLEAAQAMADRALADGRAAREQLTG
LTGQLQLAQGDVTAIGQQATALQQHTDPDPEQVKQAIRDSEAAKQRLADVQGRVASGQQA
LNAAKSLAEQARQLRDGAAQECKREIAAASDAGIQPRSFWQKLGEFLKGLWDVVCEVAKW
VALVAGIIAMIIGGPLAWIALAAGAVLLVKAIVDFAQGKGSITDLLFAVLGIIPGVRGLT
SLSRLSALYKAGGLKAIAQAALTSMKNTVRGLATTVTTAARGVVDVVKTGFSKLTGKINK
IPVTTSKRTFEIPACGDPVDVSTGRVFLPETDLDLPGSPPLLLERTHRSDYRSGRLFGVS
WASTLDQRIVVESDAVHMLAADGTLLTYPVPGAEGPVVPGHGRSLPLRRSGDGFLVTDPA
TGRSLLFAAPVADPEPDLVAPLLPREVLPESAGTVPSRTAELVAIVDREGGRIEVLRDGR
GAPVEVRHGDGRRIAVTTEDGQITALHLVPATGGEPVLLRTFGYADGHLVTVAGPAGQTM
RFGYDGDGRMIRWDDSNGQWYAYTYDADGRCVLGEGRDGYFGYRFDYDPDQRRTSATDSL
GHTTVYQLNEDLQVVAETDPLGNTTRSEWDSQHRLLSRTDPLGRTTRFLYDADGGLEALL
RPDGSSAKVVHRGGRIAAVTVTGDDGRLCRRDYGRAEAPDPTVDPLGAGPRPAERHRAGT
TAPARASDPASPRMLVGGAGPAVSVEARDGFGRISALGDTTGRRIVQGWTVDGQPAWREN
ADGDRRQWRYDAEGNAIAHTDELGRTTRTEYGPFDLPVATVTPSGARTTYDYDTELRLIR
VTNPAGLQWHYRYDPAGRLIEEADFDGRLSRYTRDPAGQLTRLVNAAGESFAFEYDVLGN
LIRRTAVSPTETRTTTFRYDAVGHLVEAIGPDAVLEITRDAFGRVTAESINGRAITHAYD
DSSRTVTRETPAGVGTLWSFDPDGFPIGIRMAGHEVALFHDAGGRPVAERLDESVTVVRQ
FDAGDRLVRQRLSDGAGAEVERAFGYREDGSLTLVDDSREGVTVFRLDDEGRVTAVDGPG
RREDYRYDAAGEVVEASASVAGATVPGDRRYQGTQLVEAGGIEYRYDPAGRLVQRRDHGR
VWTFRWDADGRLHGVITPDGGRWRYRYDPLGRRIATQRLTDGPADAPLDGPVLNQTDFAW
DGPVLVEESDATGRTVTWQHDLDGSRPLVQVDGDRLHLLICDPNGAPTDLVAADGTVIRG
SAPSLWGHHAGAGTPLRFPGQYADAETGLYYNLHRYYDPRTGRYLSPDPLGLSAGPSPVR
YVDDPLLQNDPLGLSPRSCTIGKRPRYDDDAPTELDDLLNDPEMLLAGSALKKFKISAPP
KTKFPTPPGNLLIGDMKTALAKYDSDFANASLAKFHGPQDQSAVLSDVFNIGSKTPKLEG
WSVEWLNKFERTGGVSDYLKNADVENSWVRGHLLNEDFGFTGHTHNFAPMTTMGNNAFKN
GFEQRVKDAFVRMDQLQRLHPQKFDQLGSTFTVDIRVTPSREGLFDGVPGVDVAELAIPK
HIRVEAQYMIDGKPLPDSVLKDLNSTIWKERPVKPLPSNNTMNPVTGEWDPPVPTKF
Download sequence
Identical sequences G8SLS0
WP_014690606.1.1565 WP_014690606.1.34629 gi|386848589|ref|YP_006266602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]