SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81428276|ref|YP_395276.1| from Lactobacillus sakei subsp. sakei 23K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81428276|ref|YP_395276.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Formyltransferase 1.07e-59
Family Formyltransferase 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81428276|ref|YP_395276.1|
Sequence length 189
Comment phosphoribosylglycinamide formyltransferase [Lactobacillus sakei subsp. sakei 23K]
Sequence
MRVAIFASGTGSNFEAIADNQRLQQAGLEIVQLVCDRPQAAVIEKAHRREVPVTVLAPRQ
FENRQAYEQAVVAQLAPLAIDYIILAGYMRIITPVLLGTYPQRIINIHPALLPDFPGIHG
IEDAYRAKVSETGVTVHYIDEGVDTGPIIAQATVPVKPNDTLATLEARVHAVEHQLYPAV
IYDLVQKNN
Download sequence
Identical sequences Q38XW4
gi|81428276|ref|YP_395276.1| 314315.LSA0661 WP_011374370.1.13714 WP_011374370.1.42590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]