SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81429211|ref|YP_396212.1| from Lactobacillus sakei subsp. sakei 23K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81429211|ref|YP_396212.1|
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.62e-53
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 346-451
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81429211|ref|YP_396212.1|
Sequence length 459
Comment ATPase [Lactobacillus sakei subsp. sakei 23K]
Sequence
MLERAFQNEIRCHQFWPTGAKVIVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELR
TESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQTGIEAAAREFRYQFFEHLMTAEKADYL
VTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANN
ITSFEDQTNYETTVLRNRVRHTLVPFLKQENGQILQNANRFSQQLTALLGQQAQLATTLL
PLLDLKVTDKVISGQLKAIKTLPTAQQTAIWQLIIKQHFPQISPLKETQLQQLKQLIQST
VKPQGQLALGQRILFTKIYDRFQIGETTIGEIAAKDEKIRILMLNKWCVLPNNEQIGIFE
INHLPRKLSGQQLIWLADEQWPIVAKPCQLTDAIMIDKTHHKTLKRLFIDLKVPQEKRLN
SWGIWSQETLIGHPEFRVSALFIHEQTGKIRYVLCYANE
Download sequence
Identical sequences Q38V78
314315.LSA1599 gi|81429211|ref|YP_396212.1| WP_011375292.1.13714 WP_011375292.1.42590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]