SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFQ28462 from Glomerella graminicola 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ28462
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Pre-PUA domain 4.84e-34
Family Nip7p homolog, N-terminal domain 0.000074
Further Details:      
 
Domain Number 2 Region: 100-175
Classification Level Classification E-value
Superfamily PUA domain-like 1.22e-24
Family PUA domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ28462
Sequence length 187
Comment pep:novel supercontig:GCA_000149035.1:GG697341:164252:164953:-1 gene:GLRG_03606 transcript:EFQ28462 description:"60S ribosome subunit biogenesis protein NIP7"
Sequence
MRPLTEKETETLFNKLASYMGSSLKNLIAPLDNGPEPDRYVFRMIRDRVYYVRLSVANLA
TSIARDKLLSIGICLGKFTKTGKFRLHVTALPILSEHARYKIWVKPNGEMPFLYGGNIVK
AHVGRWSEDCPEHQGVIVFSMDDKPLGFGVTARSTAEARRLDPTGVVCFRQSDCGEYLRD
EDTLFAG
Download sequence
Identical sequences E3QC74
EFQ28462 XP_008092482.1.39555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]