SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000207 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000207
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.83e-45
Family FCH domain 0.011
Further Details:      
 
Domain Number 2 Region: 515-601
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-21
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 3 Region: 418-485
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000104
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000207   Gene: ENSMLUG00000000220   Transcript: ENSMLUT00000000225
Sequence length 687
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:284932:381914:1 gene:ENSMLUG00000000220 transcript:ENSMLUT00000000225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKQGIQKLASQYLKRDWPGIKADDRNDYRSMYPVWKSFLEGTMQVAQSRINICENYKNFI
SEPARTVRSLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIE
AKSKLSLFQSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVN
IMKALDGNVYDHLKDYLIAFSRTELEACQAVQNTFQFLLETSSKVVRDYNFQLFLQENAV
FHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDDL
ECHGAPASEQSRVELEQKIDEAKENIRKAEIIKLKAEARLDLLKQIGISVDTWLKSAMNQ
VMEELENERWARLPAVTNNGTLHSLNADTEREEEEFEDNMDVFDDSSSSPSGTLRNYPLT
CKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSL
LSMLQSLAALDSRSHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTEDELSFPEGAI
IRILNKENQDDDGFWEGEFSGRIGVFPSVLVEELPASENGDAPGMREIRISPSPKPPGSL
PPLPLYDQPPSSPYPSPDKRSSQYFPRSPSANENSVHAESPGFSQPPRQTPETSYGKLRP
VRAAPPPPTQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences G1NST7
ENSMLUP00000000207 ENSMLUP00000000207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]