SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000634 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000000634
Domain Number - Region: 270-297
Classification Level Classification E-value
Superfamily Ribosomal protein L20 0.0968
Family Ribosomal protein L20 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000634   Gene: ENSMLUG00000000694   Transcript: ENSMLUT00000000696
Sequence length 696
Comment pep:novel scaffold:Myoluc2.0:GL429879:1259781:1269563:-1 gene:ENSMLUG00000000694 transcript:ENSMLUT00000000696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWPEVENAQPNPGKYIEGITNQQPPTDGKGKETNKIWPDVAGTSETKIELLPSHSTAT
LIEEPTDTEDPWDLPELQHKGIKWTERDTEGKILCILQGIGKFLLLLGFLYLFVCSLDIL
SSAFQLVGGKMAGKFFSSNSIMSNPLAGLMIGVLVTAMVQSSSTSTSIIVSMVASSLLTV
RTAIPFVMGANIGTSITNTLVALMQAGDRNVFRSRAFAGATVHDFFNWLSVLVLLPVEVS
THYLEVLTNLIVDSFHFKSGENAPELLKVITNPLTKQIIQLDKKVINQIAMNDPAAQNKS
LIKIWCKTLTNVTQMNVTVPSIQNCTSPDLCWTNGFHTWTIKNVTHRENIAKCQHLFVNA
NLLDLVVGIILLVTSLLVLCGCLIMIVKVLGSVLEGRVAVVIKKTINTDFPFPFSWLTGY
LAILVGAGMTFIVQSSSVFTSTLTPLIGVGVISIERAYPLTLGANIGTTTTAIMAALASP
GKTLRSSLQIALCHFFFNITGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLVILF
FLVPLSVFGLSLAGWPVLVGVGVPIILVILLVVLLKLLQARCPRILPKVFQTWNFLPLCM
RSLKPWDIAVSLATGCCMRNCCCCCRICCRFCCRLCCPTCCRCSKCCQDPVEEEDIHIKV
PESFRSLSMVVEAPEGVPKSKVDALNTNTTSSLTAL
Download sequence
Identical sequences G1NTW5
ENSMLUP00000000634 ENSMLUP00000000634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]