SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000726 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000726
Domain Number 1 Region: 2688-2965
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.42e-67
Family Protein kinases, catalytic subunit 0.00000403
Further Details:      
 
Domain Number 2 Region: 1915-2111
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-54
Family DBL homology domain (DH-domain) 0.0000124
Further Details:      
 
Domain Number 3 Region: 1262-1440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2113-2235
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-33
Family Pleckstrin-homology domain (PH domain) 0.00066
Further Details:      
 
Domain Number 5 Region: 1444-1562
Classification Level Classification E-value
Superfamily PH domain-like 1e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2484-2579
Classification Level Classification E-value
Superfamily Immunoglobulin 6.77e-23
Family I set domains 0.0047
Further Details:      
 
Domain Number 7 Region: 261-397
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1076-1213
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 826-979
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 485-626
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2327-2391
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000911
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 17-171
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000157
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 13 Region: 1613-1691
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000019
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 14 Region: 175-291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 15 Region: 631-692,720-753
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000432
Family Spectrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000726   Gene: ENSMLUG00000000763   Transcript: ENSMLUT00000000794
Sequence length 2988
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:62692201:62889732:-1 gene:ENSMLUG00000000763 transcript:ENSMLUT00000000794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFISGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLI
SYLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQ
RTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNAT
HMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQS
SDSFPKKNSGSGNADLQSLLPKVSAMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQD
AEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRL
VESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKPSKYMSNVDSWC
KACGEVDLPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLT
ASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENH
GEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEI
YQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEA
VQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRWARPEIPFPSLLPLRDSAISNNKTPH
NSSISHIETVLQQLDEAQAQMEELFQERKIKLDLFLQLRIFERDAIDIISDLESWNDELS
QQMNDFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDR
DVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESML
NAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAE
KVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPN
SETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHVKAPEQQVK
NILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGS
SIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRD
FSLRMEKYRTSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVKLRDAAHELNEEKRKSA
RRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEF
HNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQ
RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHL
SMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSK
YLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVI
QERTIHLKGALKEPIHIPKTAPAARHKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLD
SDKLSGGCELTVVIHDFTACNSTELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGL
VPCGSLCIAHSRSSMQCDFCFYKLKESISKTKYSLSVSSNDASPPASVASLQPHMMGAQS
SPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSA
ATPQDETVEESSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLV
RPTSSETPSAAELVSAIEELVKSKMVQSLNTSRSSLNVQRGCFDNSLLSSSSPIDEMEER
KSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQI
YDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFED
LKQRLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPKRC
NDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRVFLFEQIVIFSEPLD
KKKGFSTPGFLFKNSIKVSCLCLEESVENDPCKFALTSRTGDVVETFVLHSSSPSVRQTW
IHEINQILENQRNFLNALTSPIEYQRNHSGTGVFQSHPPRPRTCPRRPGARQRLASSEAP
GSTHLGHTTLPLPPPLEPKVARGHPPRDTQSPSAFLSPSPPLQSESSSSSNISTMLVTHD
YTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIMES
PDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLGNKVSVKKFPGSSQK
EKVQGQLDSACRMGLLSPNYIYDVPPEFVIPLSEVTCEAGETVVLRCRVCGRPKASITWK
GPEHNTLNNDGHYSISYSDLGEASLKIVGVTTDDDGIYTCIAVNDMGSASCSASLRVLGA
ASGRPGLWGFLGWLTSRHRSQGQASDSGHWVLEPTSQLELVSLSLSLSLSLSLTSQAFWW
ACPPVPSTCSRHPWWNPSLWSKPLLSLLPGKAPSRPGSDGILVTWKDNFDSFYSEVAELG
RGRFSVVKKCDQKGTKQTVATKFVNKKLMKRDQVTHELGVLRNVQHPLLVGLLDTFETPT
SYVLVLEMADQGRLLDCVVRWGNLTEGKIRAYLGEVLEAVRYLHNCRIAHLDLKPENILV
GQSSATPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTY
VLLSGVSPFLDDSVERALNICRLDFSFPDYFKGVSQKAKDFVCFLLQEDPARRPSAALAL
QEQWLQAGHATAKAVLDTSRLTSFIERRKHQNDVRPIRSVKNFLQSRL
Download sequence
Identical sequences G1NU45
ENSMLUP00000000726 ENSMLUP00000000726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]