SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000828 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000828
Domain Number 1 Region: 1769-2055
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.18e-74
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0004
Further Details:      
 
Domain Number 2 Region: 712-878
Classification Level Classification E-value
Superfamily GroEL apical domain-like 8.89e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00055
Further Details:      
 
Domain Number 3 Region: 387-518
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 181-253
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 665-718,871-891
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000101
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000000828
Domain Number - Region: 1432-1534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0691
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000828   Gene: ENSMLUG00000000897   Transcript: ENSMLUT00000000905
Sequence length 2069
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:11530033:11599021:1 gene:ENSMLUG00000000897 transcript:ENSMLUT00000000905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKEKT
SAISFSLLNSLVFQNNAKLPFATERAEGGQGEQQSLSGSWTSPQLPSRAQSVRSPTPYKK
QLNEQLQRRSSTVLETRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQ
YWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYC
RKIALSYAHSTDSNSIGEDLSALSDSASSLSVLDPGEPRTPVGSRKASRNIFLEDNFAWQ
STSNICYSLIHPESSNTSLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYET
SVSPQANRTYVRTETNEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIV
GKELVNWLIRNGHITTRAQAIAIGQAMVDGRWLDCVSHHDQIFRDEYALYRPLQSTEFSE
TPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLTNSASPSKRTSVSSFQST
VDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKVECLISDGGGQQLSISDAFIK
ESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLH
SESLSPSWRDIIVSLVCQVVQTVRPDVKNRDDDMDIRQFVHIKKIPGGKKFDSVVVNGFV
CTKNIAHKKMNSCIKNPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDV
RPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLG
TCHKFYMQIFQLPNEQTKTLMFFEGCAQHLGCTIKLRGGSDYELARVKEILIFMICVAYH
SQLEISFLMDEFAMPPTLTQNASFHSLIEGQEDEGAAQEPFSGSPLPREPDLPPEFLPCD
GSSLLESGLVFEKGDQESDSVPQDAAPVKHQEYATAACPAGVPCALFPSIPESLLLLHVD
EQQGASGTEQPETLQQTDELEDPKSQMKAFRDPLQDDTGLYVTEEVTSSEDKLKTYSLAF
KQELKDVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKELKEMESRRKKQ
LLRDLSGLQGMNGSVQAKSIQVLPSHELVSTRIAEHLGGSQSLGRMLADYRARGGRIQDA
SGTPSVKSGSRTEGDEEKGLIPSDAVWSSKVDCLSPVNHQRLCVLFSSSSAQSSNAPSAC
VSPWIVTMEFYGKNDLTLGIFLERYCFRSSYQCPSMFCDTPMVHHVRRFVHGQGCVQIIL
KELDSPVPGYQHTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANA
EPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKVFIKRQAPLKVSLLQDLKDF
FQKVSQVYLAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKVQARLMSSS
VDAPQQLQSVFESLIAKKQSLCEVLQAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEES
KISTVDAPPRNVSPGLPNGEKEDRFLSNLSSQSSTSSVHLQLPTPPEAMPEPAGGGPPEL
DSASVSEDVFDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHE
RVPIAVCEKEPSSIIAFALSCKEYRNALEELSKVSPRNSAEEGPPTTSTLDSRPKSSSPI
RLPESSGGQTNRTAEAEPQPNEVDGGDTQKKQLTNPHVELQFSDANAKFYCRLYYAGEFH
KMREVILGSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFA
PHYFSYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFD
LKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRASIRSDSHFLSS
HLIIDYSLLVGRDDTSNELVVGIIATDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSP
ELYRTRFCEAMDKYFLMVPDHWTGLGLNC
Download sequence
Identical sequences G1NUD5
ENSMLUP00000000828 ENSMLUP00000000828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]