SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000932 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000932
Domain Number 1 Region: 650-745
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 155-221
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000145
Family Ras-binding domain, RBD 0.036
Further Details:      
 
Domain Number 3 Region: 394-430
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000432
Family DBL homology domain (DH-domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000932   Gene: ENSMLUG00000001017   Transcript: ENSMLUT00000001021
Sequence length 808
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430596:174310:187682:1 gene:ENSMLUG00000001017 transcript:ENSMLUT00000001021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTGPGVGGRTPRHCAAKPNGSLSFVSGCPSYLRPRKRPWLHPVCHHADCQQLHRRGPLN
LCQACDSKFHSAMHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEESSVDGK
GDQRSRDQRLLKKKKARRRHTGPQAKECFTLKFLNVDIETEIVPGREEEGPWEVLLPIFE
RKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGVKDSKSLSL
PILRPAGAGPPGLERADPQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPAPSSCSLP
SGSSGGGNDSWKNRAASRFSGFFSSGPSASVFGREVDKMEQLEGKLHAYGLFGLPRLPRR
LRFDHDSWEEEGDEEEDEDDACLWLEDSWRDLIDGHEKLTRRQCHQQEAVWELLHTEASY
IKKLRVITNVSGAQSHPICSLWVPLSPRRVRTFAEGAVARPPSGKEASRAAPWVSPGPPH
LRFSHPHPQSHGRIFPHPGPDRRPFPGCPPREETLQLLLGGQPEDERRERTARCLLGGHP
RCAGAPCPAPACPCRVWATPFPGAPPGGEPVVSSAAQPGTDACTELVIHHAPCSPEPASQ
DFKVASQCSLSSLISSFNLNKSQVYSSMKENCLVLPFALPFNSALTFMAMRTGRGRCSGQ
MDVYCFLFTDLLLVTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVG
AYTFQASGQALCRGWVDSIYNAQNQLQQLRAQEHGGSQQHLQSLEEEEDEQEDEEEDEED
EEGGESSTSAASSPTILRKSSNSLDSQH
Download sequence
Identical sequences G1NUM6
ENSMLUP00000000932 ENSMLUP00000000932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]