SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000937 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000937
Domain Number 1 Region: 581-787
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 381-504
Classification Level Classification E-value
Superfamily PH domain-like 3.82e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 73-143
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000354
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 4 Region: 263-299
Classification Level Classification E-value
Superfamily WW domain 0.0000464
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000937   Gene: ENSMLUG00000001022   Transcript: ENSMLUT00000001026
Sequence length 788
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:2187451:2195252:1 gene:ENSMLUG00000001022 transcript:ENSMLUT00000001026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESFTLCSGDTERERGGQIFPCPTQESHHRPEQASFAPGSSDGPQKVTGLATMLSGQWWPS
TWGNLGLGPKNTSQGPQLCALYAFTYTAADGRQVSMAEGDRFLLIRKTNSDWWLARRLGA
PSTSRPIFVPAAYMTEESICSQSPATIATRQSRWTHGPELFPGSLEALPPSQATTGRAQS
TSQQPPSLPPKIYRSVSVTNLRPTLLKPSQDGQSGRSLSREDLLTEANANVAGPQLPMSE
PPVYCNLVDLRRCLQSPPPSPACAPLQRLDAWEQHLDPNSGRCFYRNSLTGCKSWKPPRR
TRTQETNPGSMEGTQTLNRDNGVLQPQAKGSDSDTGSPELLNPQGSPCLPRRTSQLNPPD
QPAARQPLRPLPQVLDDPHEVEKSGQLNVTKIAQGGRKLRKNWCPSWVVLAGNSLMFYRE
PPRAAPSSAVWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEFLLQSDLEA
ELRAWHHALRAVIERLDRENPVELRLSGSGPAELGELSAGEDEEEESEPVPKPLLRFGGR
RSSSRCPDGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPS
FVRRCVAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGQL
DFDSAEWDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALEQRLSQIRELIASMPKPNH
DTLYHLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQEISDPAAHAFYPGQLVQLML
TDFTSLFS
Download sequence
Identical sequences G1NUN1
ENSMLUP00000000937 ENSMLUP00000000937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]