SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001022 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001022
Domain Number 1 Region: 189-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-49
Family DBL homology domain (DH-domain) 0.0000148
Further Details:      
 
Domain Number 2 Region: 384-510
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-29
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001022   Gene: ENSMLUG00000001115   Transcript: ENSMLUT00000001118
Sequence length 618
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:2072254:2081271:-1 gene:ENSMLUG00000001115 transcript:ENSMLUT00000001118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLERPLPSHTVPLMNFXGGMLRACLITRAGGPPKRSPLGPEGTEPESACTEGGQRGERE
PEVPAWAPLPESYSIADSEGSISASAASGLAVPSGPTSGFSSEPCSPGPPGPSSGLRRWL
DHSKHCLSVETEVDGGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDETKLPEEES
LSQAPESEEEQKKKALERSMYVLGELVETEKMYVEDLGQIVEGYMATMAAQGVPENLRGR
DRIVFGNIQQIYEWHRDYLLGELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHV
VSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELERA
VEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRVF
LFEQIVIFSEALGGGVRGGTQPGYVYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQ
RYVLQTADPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGSP
GKMRPGDRAQVSTHRPINGSLPSLLLLPKGEVARGSLPLDTQALSDIPQMPRDSPSVPPI
SNTPPCQARLAKLDEDEL
Download sequence
Identical sequences G1NUV4
ENSMLUP00000001022 ENSMLUP00000001022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]