SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001083 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001083
Domain Number 1 Region: 728-904
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-41
Family DBL homology domain (DH-domain) 0.0000822
Further Details:      
 
Domain Number 2 Region: 914-1029
Classification Level Classification E-value
Superfamily PH domain-like 4.33e-35
Family Pleckstrin-homology domain (PH domain) 0.00094
Further Details:      
 
Domain Number 3 Region: 190-330
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000102
Family CRAL/TRIO domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001083   Gene: ENSMLUG00000001181   Transcript: ENSMLUT00000001183
Sequence length 1188
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430041:741415:749639:1 gene:ENSMLUG00000001181 transcript:ENSMLUT00000001183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEGSLEDGDESPDSRGQATDWRFAVCRFRDAWDEEEPAPQVQVKDPSPPRPPAEAAQGDG
LQGGPLCGELPPTPGQMAVDGSGDGQRVALGGSSGKSEEPVPSEVKSLLCLMASHLSLAQ
GSSASQGGDLAGDPDSGRVMTTDLDPGLGSDSVNLGGPLSETSSQLLEADPRGSSLPKPA
DYLLQDLAWELLASGMAALPGTRDVEGRAVLLLCAHSHTWLHPTCSSQELIRLLLYLRSI
PRLEVQALGLTVLVDARICPPSSSLFWGLSQLQEAVPGSVHQVLLVGKMPKEVPSGLQVE
QLSSLQSLLTHISTSWLPASLGGGLPYCHQAWLHFRMRLEALLQSCQVVCTLLQGAIETV
KAMPQPMETGEVDQLLQQAQVLMQHVLDSPQLAWLQCQGSLELAWLKQEVPEVTQSPDYR
PAVNKVDELYGCVDGLLHQLTLHSNRRIQALELIQTLKAQEGGLHQIEVWLQQVGWPALE
EPGEPSMDTLLQAQGPFRELDRVAQEQVRQGEKFLQPLTGWEAAELGPVGARFLALQAQL
TEFSRALAQRRQWLADAERLSCFFKQVCLDMAEEGQRVLAELSRAPRVCCNAAAALTKQP
ELPPPKMWALATGLGSEGIRQQCRWAWAQCQDTWLALDQKLEAALKPLPTGSTASPCVSQ
VPVVPATPPLRKAYSLDRNLGQSLRESVYHCHQAASVAACHRPEAGAPPGLSPTMLLPGS
SDPRSPSRLQLVLAEMVATEREYVRALDYTIENYFPELDRPDVPQGLRGQRAHLFGNLEK
LRDFHCHFFLRELEACTQHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMASYGHSFFK
DKQQALGDHLDLASYLLKPIQRMSKYALLLQELARACGGPRQELSALQAAQSLVRFQLRH
GNDLLAMDAIQGCDVNLKEQGQLVRQDEFTVRAGRHKSLRRVFLFEELLLFSKPRRGPTG
IDMFAYKRSFKMADLGLTECCGDSNLRFEIWFRRRKARDTFVLQAASLATKQAWTADISR
LLWKQAVHNKEMRMAEMVSMGVGNKAFRDIAPNEEAISDRTINYVLKCREVRSRASIAVA
PLDCESPYLGASSSLPADPASGSVLGSLNLHLYRDPTLQGLRWPLYSTSFPEETALEAEE
ELGSQPSLTPEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLSYV
Download sequence
Identical sequences G1NV08
ENSMLUP00000001083 ENSMLUP00000001083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]