SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001124 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001124
Domain Number 1 Region: 1674-1714,1751-1946
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-66
Family Plakin repeat 0.0000106
Further Details:      
 
Domain Number 2 Region: 218-346
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000166
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1584-1671
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000246
Family Plakin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 632-758,786-813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000331
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 5 Region: 91-160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000245
Family Spectrin repeat 0.007
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001124
Domain Number - Region: 520-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00225
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 1078-1158
Classification Level Classification E-value
Superfamily Ferritin-like 0.00465
Family Ferritin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001124   Gene: ENSMLUG00000001224   Transcript: ENSMLUT00000001226
Sequence length 1967
Comment pep:novel scaffold:Myoluc2.0:GL430813:102048:114865:1 gene:ENSMLUG00000001224 transcript:ENSMLUT00000001226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDRLNSEQSQALQHQQEAGRSLKEAEVLLKDLFLDVDKARRLKHPQAEEIENDIKQLHER
VTQECAEYRALYEKMVLPPSVGPRVDWARVLEQKQKQVREGPYGPGMAELEQQIAEHNIL
QKEIDAYGQQLRNLVGPDANSIRNQYRDLLKVAAWRGQSLGSLYTHLQGCTRQLSALAQQ
QHRILQQDWSDLMADPVGVRREYEHFKQHELLSQEQCVNQLEDDGERMVELGHPAVGPIQ
VHQEALKMEWQNFLNLCICQESQLQHVEDYRWFQEEADSVSQTLAKLSSSLDTQYGPAPG
GAPGAPTELLRQLEAEEKKLAAAEKTIGDLQRRSQEVAPPQRRNPPQQPLHVDSICDWDT
GEVQLLRGERYTLVDNTDPHTWVVQGAGGETQRAPAACFCIPAPDPAAVTRASKLAAELQ
ALKQKLATVQSRLKASVTEPCRPGQQVPTGPATADPQAQKLLTQMTRLDGDLRQIERQVL
AWARAPLSPAAPLEDLEGRMRSHQGTAQQLRSLGAEKEAAQRECEAFLSARPVGPAALHL
PVALNNVKNKYSDVQALCNLYGEKAKAALGLERQIQDADRVLRGFESALAQEAPLPAGPG
ALQERVGELQRQRRELLEQQACVLGLHRELKATEHACGALQNNFHEFCQDLPRQQRQVRA
LTDRYHAVGDQLDLREKTVQDAGLTYQQFKNCRDNLSSWLEHLPPNQVRPSDGPSQIAYK
LQAQKRLLREIQGRERDRAAASRLSQDLQEALQDYALQADTYRCSLEPSQAGSAPKRPPV
APLQESIQTQEKQLTEAYTEAVAVHQEQLHQLEFARRMLEKKELSEDIRVAHGAQQGSEG
PAQAGREAEALKLQLEEERKRVAQVQRELVGQRDRLLQLRTQRPLERLEEKEVVEFYRDP
QLESSLLRVKSQVEDESRKRAGLQADLEVAAQKVVQLESKRKTMQPHLLTKEVTQIEKDP
GLDSQAAQLSGEIQHLGAENAAVSARLEQLKAELLALEQQEAQVKEKVVVKEVVKVEKDL
EMVKAARALRLQIEEDAAQRKRAEQAVAELQARIGDLERAISSVQPKVIVKEAKKVEQDP
GLVKEAARLRGLLEGERSKNAALAKELKELQGKYSAEAKQKPKVELQERVREIFQVDPET
EREIARLRAELQETASKRSGVEREVERLLPDLAVLRAQKPQVEYKEVTQEVVKHERSPEV
LREIDRLKAQLNELVNTSGRAQEQRIRLQGERDEWKRERSKVETKTVSKEVVRHEKDPVL
EKEAERLRQEVREAAQKRRAAEDLVYELQNKYLLLERRRPEEKVVVQEVVVTQKDPKLHE
EHSRLSRSLDEEVGRRRQLEREVQQLRAGVEEQEGLLSFQEDRDKKLAVEKELRQLSLRI
QELEQRPRAVQEKIIMEEVVQLEKDPALEESTGALRQDLDQEKARVAELHRECKNLQVQI
DVLQKTKSQEKTIYKEVIRVEKDRVLEGERSRVWEMLNRERAGRKGREETVQRLRERIDR
AEALSRTWAREEAELQKARAQASQGCRQLQQELRELERQKQQKVLQLQEEAKLLSQRSEG
ERQRATQQGQELAQLKAAILQEKDQIYTKERTLRDLHSRVSREELNQETQTRETNLSTKI
CILEPETGKDLSPYEAYKRGVIDRGQYLQLQELECDWEEVTTSGPCGEESVLLDRKSGKQ
YSIETALQCRRISKEEYHLYRDGSLPISEFALLVAGETKPCPSLSIGSIISKSPLTSPGH
QSASSFSPGFSFGLGDDSFPIAGVYDTTTDNKCTIKTAMAKNMLDPITGQKLLEAQAATG
GIVDLLSRERYSVHKAMERGLVENTSTQRLLNAQKAFTGIEDPVTKKRLSVGEAIQKGWM
PRESVFPHLLVQHLTGGLIDPKRTGRIPVPQAVLSGMISEELAQLLQDESSYEKDLTDPI
SKERLSYKEAMGRCRKDPLSGLLLLPAALEGYRCYRSASPTGPYALR
Download sequence
Identical sequences G1NV46
ENSMLUP00000001124 ENSMLUP00000001124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]