SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001202 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001202
Domain Number 1 Region: 919-1666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-260
Family Motor proteins 0.000000000216
Further Details:      
 
Domain Number 2 Region: 3036-3140
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000209
Family Second domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001202
Domain Number - Region: 2654-2678
Classification Level Classification E-value
Superfamily SH3-domain 0.00381
Family SH3-domain 0.005
Further Details:      
 
Domain Number - Region: 3141-3189
Classification Level Classification E-value
Superfamily PH domain-like 0.0885
Family Third domain of FERM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001202   Gene: ENSMLUG00000001272   Transcript: ENSMLUT00000001309
Sequence length 3256
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430280:425676:483174:1 gene:ENSMLUG00000001272 transcript:ENSMLUT00000001309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKKAKKKKKKGQEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGLHT
GPQKTKRKRKARTVLQSTSKLMTQMRMGKKKRAMRGKKPSFMVIRFPGRRGYGRLRPRAQ
SLSKASTAINWLTKRFLIKKAEESGSEQAAVDAWLSRSGSHVGSRKLPFPSGAEILRPGG
RLRRFPRSRSIYASGPVGFLPFEDEAPFRHAGSRRSLYGLEGFQDLGEYYDYHREGDAYY
DQRSLSQYEEQDPGLATYGAYSPAWPPYGDHAPGYPPEDPYDHYPLDYYGGPYYPTSAYG
YSYGYEDHEPPYAPPGGYASPYSYYDSEPYPQAYYLDPFAPYDAPYLPYDLPYDVPAWEP
YGVPYEAPYGLPYAEGIYGGGDQAIYPPEVPYLYPEEPAFAYPWVPPPIMSPHNPYAHPM
DDIAELEEPEEAAGERQGTSFRLPSASFFEQQGMDKPARSKLSLIRRFRLFPRPQVKLFG
KEKLEVPLPPSLDIPLPLGEEEEEEDEEEVPPVRTGPYAHPFWGFLTPRQRNLQRALSAF
GAHRAHRGLGFGPELGPARPATSLARFLKKTLSEKKPVPRLGGSQKARRGGPAVREAAYK
RFGLQAGGDPDRPNTPIMLRPGEASRRAAGIPKDLESPLGRAPLWSPKLERGTCLPPQHQ
SSPWTRPSKTAGRAFSRPRPIPETPFLQHLGPGPSRDSPLEDADPAVTGVFLGRHHDPGP
GELTKSASPSPEKPKEEASPGNPRPLAEPEPPSPEPPKNSPPEQKVLRLSLSHPLAARDR
MRATWPPWRRWGTLPSAPAPLKPTGAPGPLPRAGERHQAGPGRLAVVLPRVQKPSSPQRA
GPATLQPPTQLTKDPEPSLKPRAWSLLWASLWLPAGTHRPWPRAPACPASCRLGPEAAFL
PHGGPWEEVGPKSWWNKMHSIRNLPSTRFLEQHREDGVEDMTQLEDLQETTVLSNLKTRF
ERNLIYTYIGSILVSVNPYRMFGIYGLEQVHQYSGRALGENPPHLFAIANLAFAKMLDAK
QNQCIIISGESGSGKTEATKLILRYLASINQKRGIMQQIKILEATPLLESFGNAKTVRND
NSSRFGKFVEIFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQA
FSLQEAETYYYLNQTPGPALSGKSDADDFRRLLAAMEVLGFSGEDQDSIFRILASILHLG
NVYFEKYETDAQEVASVVSAREIQAVAELLQISPEGLQKAITFKVTETIREKIFTPLTVE
SAVDARDAIAKVLYALLFGWLITRVNALVSPQQDALSIAILDIYGFEDLSFNSFEQLCIN
YANENLQYLFNKIIFQEEQEEYLREQIDWREVAFADNQPCINLISLKPYGILRILDDQCC
FPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRKD
VLDLFVRSRTRVVARLFSSHAPQAAPQRLGKSSSITRLHKAHTVAAKFQQSLLDLIEKME
RCNPLFVRCLKPNHKKEPGLFEADVVMAQLRYSGLLETVRIRKEGFPVRLPFQAFIDRYR
CLVALEHNLPASGDMCVSVLSRLCTVMPNMYRVGVSKLFLKEHLHQLLESMREHVRNLAA
LTLQRCLRGFFIQRRFRSLRCKIILLQSRARGYLARQRYQQMRKSLVKFRSLVNTYVSHR
RHLKLRAERRLRVEEVRLREQEELSKREVVAVGHLEVPAELAGLLRAVAGLRPAQMPRVA
PVRTPRLQAEPRVTLPLDINNYPMAKFVRCHFKEPAFGMLTVPLRMPLTGLPVEHHAEAV
SIFKLVLRFMGDPHLHGAQEHVFGNYIVQKGLAVPELRDEILAQLANQVWRNPRTHNAER
GWLLLAACLSGFAPSSRLNKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGPGAARTF
PPTRLEWTAAQEKASMALDVGCFNGDQFSCPVHSWSTGEELAGDILRHRGLVDGWRGWTV
AMKNGAQWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPVAGRGGPRAVFGNSWD
SDEDTPTRPQPRGHMPNVADANGYCSPHEDRKALGLGGGGISRRKRDVSPLPGLDSPGEP
AVSHKGLDCYLDSLFDPVLSCGDADLEKPTAIAYRMKGGGQPGGGGGSSTEDTPKRPPEP
KPIPGLDASTLALQQAFIHKQAVLLAREMTLQAMALQQQPLSPAPRPFPPEKPQAPRGTA
KARGHETPGQAVLLRPTPKPVAPAPPAKAPRPPLKPVAAPILAQDRSSPETTLPCPELVR
YSTLNSEHFPQPTQQIKNIVRQYQQPPQGGQPQALRKDCGRVFVKRPDPHEEALMILKGQ
MSHLAAAPGTQVPREAVALVKPVTSAPRPSMRPTPALPSRSLEPAEDPVQTQLHRLPNPS
FYGYQDTPWQIFLRKEVFYPKDSYSHPVQLDLLFRQVRASLPFLPQCTQQGNGHVDYLSA
PSAQSQLDHAEAAGGTKSVEAGCGPTPHATAWEVYFRALVPTQGSVGTGVQILAVHTGIK
LLQMARGSREASGQLRVLRTYSFADILFVTIPSRNMLEFNLASEKVILFSARAQQVKTLV
DDFILELKKPGASSELHSCCAPQPPRPLRHHCSLQGNALPSQAQAPPPGSWRAGRVLRAL
SPRETPARLRLLPPPGWRLGTTHGRVGRFPSELVQPVAAPDFLQLPAEPSRGRAAAVAAA
VASTAAAWEVGRRREGSPIRTGSADRGEDGLAPPPRTMLAFAQKYFRDPQRRPQDGLRLK
SKEGRESRTLEDMLCFTKSPLQESLIELSDASLSKMATDMFLAVMRFMGDAPLKGQRERD
VLCTLLKLCAEQEALRDECYCQVVKQLTDRASSDQDSCQRGWRLLYILTAYHSCSEVLRP
PLVHFLQDVSQSPGLPFQGIAKACEQNLQKTLRFGGRLELPSSMELRALLAGRSSKRQLF
FLPGGLERHLKIKTCTVALDVVKEICAEMALTRPEAFDEYVIFLVTNRGQHVCPLRRCTY
ILDVASEIEHVESSYMLWSRVCSGTRHLSLRMSYNVTMHYNQVLPDYLKGLFSSVPAGQP
REQQLQQVSKLASLQHRAKDHFYLPSMREVQQYIPAQLFHSTAGAAWLSLVSQHRQQTQA
LSPHQARAQFLGLLSASPMFGSSFFFIQSCSNLAVPAPSILAVNQNGLNFLSTETHELMV
KFPLKEIQSTWTQRPTASSSYPYVEIVLGDVAAQCTMQLQLEQGLELCRVVAVHVENLLS
AREKQLTLPPSEITLL
Download sequence
Identical sequences G1NVB2
ENSMLUP00000001202 ENSMLUP00000001202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]