SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001299 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001299
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-34
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 186-354
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-25
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001299   Gene: ENSMLUG00000001417   Transcript: ENSMLUT00000001416
Sequence length 376
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429776:15104441:15133191:1 gene:ENSMLUG00000001417 transcript:ENSMLUT00000001416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLKYLQTHEYLLDVDSWRLFANLEELSQTSYGFVSSLFAIIKDYFDASETSPPMDFIS
VLAKHFRGSLCQSHQTYCLNYSAAVFYLESLKQREDFGIYLKWCEQNEQCRRLHLAELLV
APLHRLTRYPLLLKNIWKRSTDSTEKIMIYSIKEKVEKSIRDLEGKVKWLDNFQKCRHLQ
EIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTNRHLLYEGKLTLAESTRFLDVYL
FLFDDFLLVTKTKRNKKKVGGLDTGVLCPSLTPELQTVIKEGGSCKVLDQPIPLDRLVVK
SIDPLHVSVFGLRNAFLIQHESRYRQCIAAFLLQAQTENIKKTWMAQITAAISCFTKSQE
TKKISLFRSSTESSEI
Download sequence
Identical sequences G1NVJ7
ENSMLUP00000001299 ENSMLUP00000001299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]