SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001391 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001391
Domain Number 1 Region: 74-289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 649-787
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.0003
Further Details:      
 
Domain Number 3 Region: 305-374,432-466
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-21
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 4 Region: 509-615
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000039
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001391   Gene: ENSMLUG00000001514   Transcript: ENSMLUT00000001516
Sequence length 787
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429924:3049514:3149726:1 gene:ENSMLUG00000001514 transcript:ENSMLUT00000001516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRPLRYQSLAALVEDSQWPFLFLVSDFSYGADDYDAEGNEEQKGPPEGSETMPYIDESPT
MSPQLSARSQGSGGDSVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALL
LPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLF
QKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEA
LLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTT
PKGETRQLVKDGFLVEVSEGSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLAD
LVFPSPEESEASPHVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFEN
EFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQV
LTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSAHLYCTLEVDSFGYF
VSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKG
QIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTK
RERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDI
NAIAGTLKLYFRELPEPLLTDRLFPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLF
LLEHLKR
Download sequence
Identical sequences G1NVS7
ENSMLUP00000001391 ENSMLUP00000001391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]