SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001771 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001771
Domain Number 1 Region: 93-296
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-57
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 279-413
Classification Level Classification E-value
Superfamily PH domain-like 1.49e-31
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 398-506
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.3e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 535-629
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-20
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001771   Gene: ENSMLUG00000001942   Transcript: ENSMLUT00000001947
Sequence length 644
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430331:470320:494278:-1 gene:ENSMLUG00000001942 transcript:ENSMLUT00000001947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSHSTDRHPQVCSLRRAPGAAPGAHHARGRSPPPEGPGEKPSVGEALGSEPRTVSRRYLS
SLKNKLSSGAWRKSCQLSSCPEPGTQVPEEPEKRIVQELLETEQAYVARLHLLDQVFFQE
LLEEARSSKAFPEDVVRLIFSNISSIYQFHAQFFLPELQRRLDDWSATPRIGDVIQKLAP
FLKMYSEYVKNFERAAELLATWTDKSPRFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPR
YELLLKEYVQKLPAQAPDRADAQKALDLIFSAAQHSNAAIKEMERLQDLWEVYQRLGLED
DIVDPSNALLREGPVLKISFRRRDPTERYLFLFNNMLLYCVPRVIQVGAHFQVRTRIDVA
GMKVRELTDAEFPHSFLVSGKQRTLQLQARSQEEMISWMQACQAAIDQIEKRNETFKAAV
QGPEGAAQGQELQSEELGLRAPQWVRDNMVTMCMRCQEPFNALTRRRHHCRACGYVVCAR
CSDYRAELKYDANRPNRVCLRCYTFLTGHVLPEDKEDKRRGILEKGSAAGAERSLMSSFL
QLVGDKWGKSSTRGWCVIPRDDPLVLYIYAAPQDIRAHTSIPLLGYQVTTGPQGDPRVFQ
LQQSGQLYTFKADTEELRGRWVKAMERAASGWSPATPRTGTCLT
Download sequence
Identical sequences G1NWQ4
ENSMLUP00000001771 ENSMLUP00000001771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]