SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001849 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001849
Domain Number 1 Region: 424-489
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000413
Family Myb/SANT domain 0.0000785
Further Details:      
 
Domain Number 2 Region: 625-677
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000579
Family Myb/SANT domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001849
Domain Number - Region: 174-220,299-326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0959
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001849   Gene: ENSMLUG00000002022   Transcript: ENSMLUT00000002031
Sequence length 2452
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430122:187176:389821:1 gene:ENSMLUG00000002022 transcript:ENSMLUT00000002031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRPGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSATVLPLVHMLPEGLRSSADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQIHKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RLRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFI
NMNGLMEDPMKIYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYY
YLTKKNENYKALVRRNYGKRRGRNQQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEE
KDEKEDSKENTKEKDKTEGIAEETEEREQAIPRGRKTANSQGRRKGRITRSMTNEAAAAS
AAAAATEEPPPPLPPPPEPISSEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKS
EAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASN
EEENPEDSEGAENSSDTESAPSPSPVEAVKPSEHSTENLTSRGNTEPAAEHECTTETAPI
ASPSSAPSTKPAENESVGTQANNKVTVEVAEPMDIEHQEHSADVTSVLDLPTTTKAESVD
VEMGVPENNPSQVEGDTKERDLEKASEKTEPGDDDLVVAQQINVQRPEPPSDNDSSATCS
ADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPMKPNPLDLPQLQHRAAVIPPMVSCT
PCNMPIGTQVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPKREW
EEVLQPTPHHVITNLPEGVRLPTTRPTRPPPPLIPSSKSTVASEKPSFILGGSISQGTPG
TYLTSHNQASYPQETTKPSVGSISLGLPRQQESAKAATVPYIKQEEFSPRSQNSQPEGLL
VRAQHEGVVRGTTGATQEGSITRGTPTSKISVESIPSLRGSITQGTPALSQAGIPTEALV
KGPISRISEESSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLK
RSYESVEGNIKQGLSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRAT
TESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQES
RKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLTRGMPPLEIVP
ENIKVIERGKYEDVKAGEQVRSRHTSVVSSGTSVLRSTLHEAPKAQMSPGIYDDSSARRT
PVSYQNTMSRGSPMMNRTSDVTLSSSKSINHERKSTLTPTQRESIPAKSPVPGVDPVVSH
SPFDPHHRGSTTGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLY
AMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQQLGLPYPATRGIIDLTNMPPAILV
PHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHSTHLAAAASAEREREREREKER
ERIAAASSDLYLRPSAEQPGRPGSHGYVRSPSPSVRAQETILQQRPSVFQGTNGTSVITP
LDPSAQLRIMPLPAGGPSLSQGLPTSRYNTAADALAALVDAAASAPQMDVSKTKESKHEA
ARLEENLRSRSAAVSEQQQLEQKTLEVEKRPVQCLYTSSAFPSGKPQPHSSVVYSEAGKD
KGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRY
ETPGDAIEVISPASSPAPPPEKPQAYQPEVVKANQAETEARQYEGPLHHYRPQQESPSPQ
QQLPPTSQAEGQVPRTHRLITLADHICQIITQDFARNQVSSQPPQQPSTSTFQNSPSALV
STPVRTKTSNHYSPESQSQSVHHQRPGSRVSPENLVDKSRGSIRPGKSPERSHVSSEPYE
PISPPQVPVVHEKQDSMLLLSQRGAEPAEQRNDSRSPGSISYLPSFFTKLENTSPMVKSK
KQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSISSRGHSFADPASNLGLEDIIR
KALMGSFDDKVEDHGVVMSQPVGVVPGGASTSVVTSGEMRREEGDPSPHSGGVCKPKLIS
KSNSRKSKSPVPGQSYLGAERPSSVSSVHSEGEYHRQTPGWAWEDRPSSTGSTQFPYNPL
TMRMLSSTPPTPIACAAASVNQATPHQQNRIWEREPAPLLSAQYETLSDSDD
Download sequence
Identical sequences G1NWX4
ENSMLUP00000001849 ENSMLUP00000001849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]