SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001859 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001859
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000197
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 2 Region: 615-876,1038-1233
Classification Level Classification E-value
Superfamily ARM repeat 0.00000122
Family PBS lyase HEAT-like repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001859   Gene: ENSMLUG00000002020   Transcript: ENSMLUT00000002041
Sequence length 1847
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430366:59425:305879:-1 gene:ENSMLUG00000002020 transcript:ENSMLUT00000002041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYNYDARGVDELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGRG
QDETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGT
LPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEVASKQVE
ERLQEEKSQKQNMDISRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMSLYDPVESKFIS
ENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRK
LTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNH
KGQGLWVTLKLLPGDVHQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRNDIYVTLVQGD
FDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDGAISEYKSVIYYQVKQPRWFETVK
VAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKA
EDKISWESRIHLPGAEDPSGTFSWEVSGWDACGGPGRGPPGASRGGPGPGTDLASVPVDL
LGLLKWRSNTNLLQQNLRQLMKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDAL
VFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLRNYVDNAEKPGVNEQLYKAM
KALEYIFKFIVRSRVLFNQLYENKGEAEFMESLLQLFRSISAMMSSMSDQTLRVKGAALK
YLPTIVNDVKLVFDPKELSKMFTDFILNVPVGLLTIQKLYCLIEIIHSDLFTQHDCRELL
LPMMTDQLKYHLERQEDLEACCQLLSNMLEVLSRKDVGMAQRRTQCLTRDPTRQSERVPV
DMGTGRMFLGNFVACMTAILRQMEDYHYAHLITTFGKMRTDVVDFLMETFIMFKNLIGKN
VYPFDWVIMNMMQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQ
LENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPMLEMTLIPETEL
RKATIPFFDMMQFEFRHRSCVQIFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKH
KYLAKTGETFVRLVVRLMERLLDYRTIMHDESKENRMSCTVNVLNFYKEIEREEMYIRYL
YKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEI
IHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSKLLKKQAQFYENIVKVIRPKPDYFA
VGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPSEEIKSSPGQ
YIQCFTVKPKLDLPPKFHRPVSEQIVNFYRVNEVQRFEYSRPIRKGEKDPDNEFSNMWIE
RTVYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLTNDKLDSMVQQHLEDPSLPIN
PLSMFLTGIVDPAVMGGFANYEKAGAFFTERYLQEHPEAHEKIEKLKDLIAWQIPFLAEG
IRIHGEKITEALRPFHERMEACFRQLREKVEKQYGVRAMPSSLDDRRGSRPRSMVRSFTM
PSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDPDKDKKDKK
KEKRNSKHQEIFDKELRPVDAAPQGSEAVILSETISPLRPQRPKSQVINAIGSERRFSVS
PTSPTAQQTPPPVMPRTKLSFSLQSSLELNGMTGMDVAEVPPPLPLKGSMADYGNLMDSQ
DLLGSPPPPPPPPHHRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
Download sequence
Identical sequences G1NWY2
ENSMLUP00000001859 ENSMLUP00000001859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]