SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002099 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002099
Domain Number 1 Region: 416-634
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-57
Family DBL homology domain (DH-domain) 0.000049
Further Details:      
 
Domain Number 2 Region: 624-778
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-21
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 3 Region: 779-844
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002099   Gene: ENSMLUG00000002307   Transcript: ENSMLUT00000002310
Sequence length 864
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429837:4209961:4317202:-1 gene:ENSMLUG00000002307 transcript:ENSMLUT00000002310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGESQVKCFQQQFNPFGGGGRSTPQPQMLGRSKPRPQSYQSPSGLLITDFPVEDRGPLP
GGQTPSQVPTASDGRTVQRSPLLLCTHRRPGTNGRTGSPEYRVSPRLRRLKSPQTPKGAG
GSPKSPENGTVIPPAAQRLRPPPSPNASAPCSPEGDRVGSTASPLPAPAANGLTCHVDSP
GCRLQSGQTAKDPERGPSPQNRSLEQKLPLQRLPSPENELPETPSVVLSTNSPAALKVGK
QQIIPKSLASEIKISKSSSQNVEPHKRLLKVRSMVEGLGASLGPSEDEGEVENDLDSPGS
LRRGLRSTSYRRAVVSGVDFDSPTTSKKKNRMSQPILKVVMEDKEKFSSLGRIKKKVLKG
QGPFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSEEKIVIQHKPLRSTWSQLSAVKRN
GLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTESHHLFSNI
TDVCEASKKFFTELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLL
ATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCK
RALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVE
DTVLFSKRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNEELTSSPG
KNSSTMLYSRQNSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHSSGKQPPD
RTSLTQVEIIRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWFPMECAKE
ITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences G1NXJ8
ENSMLUP00000002099 ENSMLUP00000002099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]