SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002213 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002213
Domain Number 1 Region: 612-712
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000036
Family Spectrin repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002213   Gene: ENSMLUG00000002435   Transcript: ENSMLUT00000002435
Sequence length 749
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:339958:351536:-1 gene:ENSMLUG00000002435 transcript:ENSMLUT00000002435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGEEKAEVEASLDTKAPSCGRWSCREQEADTPGSVSGEQPPRLEAEGGPASPVWGTEG
LPAPLCCPSGACQSQASNTSREPVAGASQPALSCLLPPAGVGTDLHSVGSQMEDTRLSAS
EELPQATTVPRATALCSGHDADTEDDPSPLESPRVLALSQQPHISGFPFSSKWRSTVSPG
ATAPPFPSCRVSASSPGSSSQGHQEKEEPQSCSLAKVSSLELVGPQSAPSMVGPGPQLQW
SPQPVSSGGDGPGLRRRHLSFQAEYWACVLPDSLPPSPDRRSPLWNPNKEYEDLLDYTYP
LRPRPRLPRHLESRVLADPVLQDSGVDLDSFSVSPASTLKSPTNVSRSCPPADASALPFS
GPREPSFRRWHSGVPQEQGSVGLASCSQLTSTPRAAGSKDTTWERRDPALRGMKDWRTAG
KHLEVGPPQLRTWDRGWPSSGPEREKGAGQGVQRPACMESGWKPEEDLESDDEYLALPTR
LTQVSSLVSYLGSVPTLVTLPTRAAEGQSSLDVSNSDGPTSFPSDSSQSQLPSGAVPRGP
GGLEEQNHCLLRSFLHARDSAGDGSLVSSQALGVSCGPLRTRSSFPVILDQQTFLDPDLK
GQPPRRGREQGKESLMHCVKTFCCQLDELIHWLYNIADVTDHLTPPKSSLTSLKSSLQLY
RQFKKDIDEHQSLAENVLEEGEILLQCLLDNTPVLKDVLRRISKQPSELESHADHLYDTI
LASVDMLAGCTLIPDDTPVAHSSADVSGM
Download sequence
Identical sequences G1NXU8
ENSMLUP00000002213 ENSMLUP00000002213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]