SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002296 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002296
Domain Number 1 Region: 1189-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-64
Family DBL homology domain (DH-domain) 0.0000000254
Further Details:      
 
Domain Number 2 Region: 1411-1552
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-30
Family Pleckstrin-homology domain (PH domain) 0.00000175
Further Details:      
 
Domain Number 3 Region: 231-333
Classification Level Classification E-value
Superfamily EF-hand 5.99e-28
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 1566-1686
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-27
Family PLC-like (P variant) 0.0042
Further Details:      
 
Domain Number 5 Region: 1104-1187
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-26
Family SH3-domain 0.00000424
Further Details:      
 
Domain Number 6 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 1.35e-25
Family Eps15 homology domain (EH domain) 0.0018
Further Details:      
 
Domain Number 7 Region: 752-826
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-21
Family SH3-domain 0.0000246
Further Details:      
 
Domain Number 8 Region: 979-1040
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.0000331
Further Details:      
 
Domain Number 9 Region: 868-957
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-19
Family SH3-domain 0.0000164
Further Details:      
 
Domain Number 10 Region: 1048-1119
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-16
Family SH3-domain 0.0000218
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002296
Domain Number - Region: 593-717
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00293
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002296   Gene: ENSMLUG00000002494   Transcript: ENSMLUT00000002526
Sequence length 1696
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429861:592668:672243:1 gene:ENSMLUG00000002494 transcript:ENSMLUT00000002526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPAGGYITGDQARTFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSVPQPLPPVAPIATALSPATSGTALPPLMMPAPLVPSVSTSSLPNGTASLIQPLS
IPYSSATLPHTSSYSMMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKIGTTEWA
VPQPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWSLADIDGDGQLKA
EEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKIQEEEPQKKL
PVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQ
LELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQRNREQE
EIVRLNSKKKSLHLELEALNGKHQQISGRLQDVRLRKQTQKTELEVLDKQCDLEIMEIKQ
LQQELQEYQNKLIYLVPEKQLLNERIKNIQLGNTPDLGISLLHKKSLEKEELCQRLKEQL
DALEKETASKLSEMDSFNSQLKCGSMDDSVLQCLLSLLSCLNNLFLLLKELRKSYNTQQL
ALEQLHKIKHNKLKEIERKRSELIQKKKQEDEAVRKAKQGKENLWRENLRKEEEEKQKRL
QEEKTQEKVQEEEKKTEEKRCKDTDKNRATKEKSEPASELVNYRALYPFEARSHDEMSFN
SGDIIQVDEKTTGEPGWLYGSFQGKFGWFPCNYVEKMPSSEKSVSPKKAILPPTVSLSAT
STSDESLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENL
KAQALCSWTAKKDNHLNFSKHDVITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVRR
EEPEALYAAVNKKPTSTAYTVGEEYIALYPYSSVEPGDLTFSEGEEILVTQKDGEWWTGS
IGDRTGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLIL
ILKKNASGWWQGELQARGKKRQKGWFPASHVKLLGPSSERTTPAFHPVCQVIAMYDYAAN
NEDELNFSKGQLINVLNKDDPDWWQGEINGATGLFPSNYVKMTTDSDPSQQWCADLQTLD
TMQPMERKRQGYIHELIQTEERYVDDLQLVVEVFQKRMAESGSLTEGEMTLIFVNWKELI
MSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDE
DTDFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHVDHSSLKLA
LERAEELCSQVNEGVREKENSDRLEWIQTHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKL
HKTKSNKELHGFLFNDFLLLTHLVKQFAVSSGTEKLFSSKSNAQFKMYKMPIFLNEVLVK
LPTDPSSEEPVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKRERAYQAR
SQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTLQDTLNPKWNFNCQ
FFIKDLHQDVLCLTMFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPTTRRLLLHEVPTGE
VWVRFDLQLFEQKTLL
Download sequence
Identical sequences G1NY23
ENSMLUP00000002296 ENSMLUP00000002296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]