SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002508 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002508
Domain Number 1 Region: 17-190
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-45
Family DBL homology domain (DH-domain) 0.0000318
Further Details:      
 
Domain Number 2 Region: 176-318
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-34
Family Pleckstrin-homology domain (PH domain) 0.00075
Further Details:      
 
Domain Number 3 Region: 338-448
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 433-562
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-28
Family DEP domain 0.0012
Further Details:      
 
Domain Number 5 Region: 633-699
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000197
Family PDZ domain 0.016
Further Details:      
 
Domain Number 6 Region: 537-628
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000776
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002508   Gene: ENSMLUG00000002736   Transcript: ENSMLUT00000002757
Sequence length 1561
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429844:995796:1151551:-1 gene:ENSMLUG00000002736 transcript:ENSMLUT00000002757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLQRMNQCAASKVDKNVTEETVKILFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGT
CFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLSGRKNTDVPLEGYLV
TPIQRICKYPLILKKQELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLE
EWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRRLKN
SKTSTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAK
TPEEKHEWLEAILKERERRKSLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLT
TFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRY
DDGTFYPRNEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQG
DCRTREEAMIFAVGLCDNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLK
VVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLV
FMRPFNEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGYGPSVVHAVGR
GTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSLESA
QEDLQKSNTKPPGDEAGDSFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYE
YDSTAGIKCNVVEKMIEPKGFFSLTAKILEALAKSDDHFVQNCTSLNSLNEVIPTELQSK
FSAICSEKVEHISQRISSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVME
VSYPKTSTSLGSAFGVQLDSRKHNAQDKENKSEQGKLSPMVYIQHTITTMAAPSGLSLAQ
QDGHGLRYLLKEEDLETQDIYVKLLGKLQAALKEVEMCVCQIDDLLSSITSSPKLERKTS
ECLVPTDSDNEKGERNSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSVASFTSIC
SSQCSSYFHSDEMDSGDELPLSVRISHEKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAF
EQTKYLTPGRGLQEFQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRSLAQNIRKFVEEVKC
RILLALLEYSDSEPQLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASR
RWLDQIANAGVLFHFQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVP
LTYQVEGSRQALKVYFYLDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVS
VEEFQAQINAASLEKVKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLLRPLNALDELYRL
VASFIRSKRTAACANTACSASGVGLLSVSSELCSRLGACHVIMCNSGVHRCTLSVTVEQA
IILARSHGLPPRYIMQATDVMRKQGARVQNTAKNLGVRDRTPPSAPRLYKLCEPPPPVGE
E
Download sequence
Identical sequences G1NYL3
ENSMLUP00000002508 ENSMLUP00000002508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]