SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002679 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002679
Domain Number 1 Region: 736-810
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0000136
Further Details:      
 
Domain Number 2 Region: 495-569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000814
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002679   Gene: ENSMLUG00000002937   Transcript: ENSMLUT00000002948
Sequence length 830
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429835:3632638:3711950:-1 gene:ENSMLUG00000002937 transcript:ENSMLUT00000002948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKADVKSLMAKFSAVGDPTEEVSASSRPFKVTGQNSPSGLQAKKNFFNNQGNASPLTGP
SNVPKFGGPKPPLGVKPPPEEKPELEPKPPFLKPAGVGQRFGSPAPRDPEGRAAFLRPVG
PKPNPPREDAKPVFPRPPGNKPSLHGGVNQDHDLKPPGPKPRFPPAAQESEQKPVFPKLS
GVQGKFVSASQDQEPKPLFPKPPFGPKPSPSLDDPHEGESPTKNASPLRGPSAPAGIRSK
TGSFRPAREDPDTKDQGGETSSSPFPGVVLKPAASRGAPGLSRKAEDRREDRKVDAAKNV
FLGKMSQEEPPALLPKAPSKVTMAGPWGQGQEKERGDKSLATPKQKPLPPLAVLGPPPPK
PSRPPHVDLAKFRKAAPANSTSKGQTPYSTASLPPPPPSHPASQPPLPASHPTQPPVPSL
PPRNIKPPLDLKSPVNEDNQDGAMHFDGAGNLDEEEESDGETYEDIEASKEREKKREKEE
KKRLEQEKKEQKEREKKEQEIKKKFKLTGPIEVIHQARACCDVKGGKNELSFKQGEPIEI
IRLTDNPEGKWLGRTTRGSYGYIKTTAVQIDYDSLRRKKNSLGPLSSRPAEDDQEVYDDV
AEQDEASSHSQSGSGDEGMFPPPPDDDIYDGIEEEDADDGSTLQVEEKSNSWSWGILKIL
KGKDDRKKSIREKPKDSESDNNEGSSFPAPPKQLDVGEEVYDDVDASDYPSPSADMSQGA
KAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTTVVPSLTSKKWGNRELQVKPGE
SLEVIQNTDDTKVLCRNDEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND
Download sequence
Identical sequences G1NZ14
ENSMLUP00000002679 ENSMLUP00000002679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]