SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002685 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002685
Domain Number 1 Region: 101-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000429
Further Details:      
 
Domain Number 2 Region: 289-417
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-26
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002685   Gene: ENSMLUG00000002948   Transcript: ENSMLUT00000002954
Sequence length 1385
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:2108879:2117576:1 gene:ENSMLUG00000002948 transcript:ENSMLUT00000002954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGARGLSLSKPSPRLSPRHRGEVCDCATVCETQTASATPAMASLRGSGSSTSLSTVGS
EGDLAPGPTPACLASRPEPLPGPPIRLHLSPVGTPGLVKPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSTEQVGTLFANIEDIYEFSSQLLEDLEGSSSAVGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLHHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWVEGPGTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRQL
GGWTGPELSAFGELVLEGSFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGPEYIYKGHI
FCCNLSVSESPRDPLGFKVADLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPSPEPVIPLLGSPRPRDARSFTPGRRNTAPSPGPSTARHGRR
QSEPVKDPYVMFPQNAKPRLKHAGSEGELYPPLEPQPSGPASGPAEDLEDTGPPTLDPSG
TSITEEILELLNQRGLRDAGPPPHDIPKFPGDSQVPRDGESLTFPALPSRDSSEEEDEEL
EMDERGPSPLHVLEGLEGSGAAEVPDIPGLTKNPAVSTLPEMSSLSEIPPIPCLPSLSDI
SSVFEMPCLPVIPGVPDIPGLSSPPTLPCDSWLHGPLQEPDEALATRRELFSGDRAGKLG
EPSSDGRAGQAREEEDGVSFPDFQPQDGTQDQDELGFRSCSEIRSAWQALEQGHLARPGF
PEPLLILEDSDLRGGSGSGKAGAPSTERAASRVRELARLYSERIQQMQRAETRASANAPR
RRPRALAQLQLSPCLPHEQAEPDTGPLPAFGHVLVCELAFPLTLAQESVPLGPAAQVQAA
APLSKQGGSLGGQGLDVSSLPEQDHRGIRIPDATTLPEQGLWNVQIPATTPFPKQEGPDV
QVPAITSPPDQEGHPEMQISTTTPLPAHRGHRDIQLPATTFFPQQECQMDIPVPTTPALL
KQGSCSRVTGLATSPMPKQEDHRDCQSPASTPLTKQGGFRDVRSPATACSQAVDPLLLHG
SSLDLQIPANTPLPLEPDLPDIQVLDTSPLPVCGSHLDHQIPANAPLSLPQDLPDIQAPA
AIAVPQPQGLMDTRIQALAPLPKQGDLPDIQAATAVPLLQEQSLTDLQVPKPTPLLEQKS
LTDIHFTAATPLPEQGSSWDIQGLSPTPVQTTMALSKPEGHPVSPVARSESSDLTPPHSP
SPPTRQLLGPNAAALSRYLAASYISQSLARRQGPGGEAPQAFRGSWSSSAPTSRAPSPPP
QPQPPPPPARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPALLASTQESAGFRRAQGAPD
APFHM
Download sequence
Identical sequences G1NZ19
ENSMLUP00000002685 ENSMLUP00000002685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]