SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002789 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002789
Domain Number 1 Region: 54-299
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-41
Family WD40-repeat 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002789
Domain Number - Region: 425-467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00489
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002789   Gene: ENSMLUG00000003058   Transcript: ENSMLUT00000003069
Sequence length 470
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429924:2277806:2283210:-1 gene:ENSMLUG00000003058 transcript:ENSMLUT00000003069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFI
VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNI
TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDIIHS
VCWNSNGSLLATTCKDKTLRIVDPRKGQVVAERARPHEGARPMRAVFTADGKLLSTGFSR
MSERQLALWDPNNFVEPVALQEMDTSNGVLLPFYDADSSIVYLCGKGDSSIRYFEITDEP
PFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQD
DLYPDTPGPEPLEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDARPPSGPRR
SQSASDAPLSQNTLETLLEQIKALREQVQAQEQRITALENMLCELVDGTD
Download sequence
Identical sequences G1NZB0
ENSMLUP00000002789 ENSMLUP00000002789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]