SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003010 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003010
Domain Number 1 Region: 360-548
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.58e-66
Family Regulator of G-protein signaling, RGS 0.00000925
Further Details:      
 
Domain Number 2 Region: 757-986
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-64
Family DBL homology domain (DH-domain) 0.0000000008
Further Details:      
 
Domain Number 3 Region: 990-1120
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-39
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 
Domain Number 4 Region: 59-139
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-22
Family PDZ domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003010   Gene: ENSMLUG00000003285   Transcript: ENSMLUT00000003311
Sequence length 1531
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430421:21539:168797:-1 gene:ENSMLUG00000003285 transcript:ENSMLUT00000003311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFPLKKPIRHGSVLNRESPADKKQRVERSASHDFDPTDSSSKKTKSSSEESRSEIYGLVQ
RCVIIQKGDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEV
VKLIKSGSYVALTVQGRPPGMPQIPLADSEGEPSVTGHMSPIMTSPHSPGASGNMERITS
PVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRAPTPKLLKEIQEAKKLLPQLQ
EQLSKAAGPAQDGAVLTSSKPCSDTHAVSEVGADPGDGLGRADCSSGDASWPSSDNAESP
KSGLKERVYLEENMEKNEVIQDTDTESLIGSPATRTAPHIIGAEDDDFGTEHEQINGQCS
CFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRIFLEFHQFFL
DRSAHLKVSVPDEISVDLEKRRPELIPEDLHRHYIHTMQERVHPEIQRHLEDFRQKRSMG
LTLAESELTKLDVERDKDRVTLEKERACAEQIVAKIEEVLMTAQAIEEDKSSTMQYVIFM
YMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKEREGEEKGKRRGFSSILGPPRRPSRP
DNSAIGRAMELQKPRHPKHSPPPPPVSPEPQDAAKSRQSGPASDGADAGCLPAGSVSSVA
SVATLSQDGGKENDMGSKPAAESPAPADLVDAPPRASSAALEFLPPPLDQVQEEEWEAER
MTEHGTPKPFRKVDSIAFGESQSEDEQFDNDLETDPPSWQQLVSREVLLGLKPCEIKRQE
VINELFYTERAHVRTLKVLDQVFYQRVCREGILSPSELRKIFSNLEDILQLHIGLNEQMK
TVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQT
FVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQI
LNYVNQAVKEAENKQHLEDYQRRLDTSNLKLSEYPDVEELRNLDLTKRKMIHEGPLVWKV
NRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLNTVLVRQV
ATDNKAFFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEPSTKPIPLPQSSPS
SEGDNDDGEPPKLKAEPHGVSVAGLQSPDRDLGLESPLLSSKPQSHPLGTSGKAEADELS
VAERRFAQAQHAERAVKEAGVSDQITTPDPYVPVSEERWALDALRNLALLEQLLAQKLSL
AEKSTQEDWPHFSRCRTAFPGVQADSGTQNFEIMKSCPGQRQMPLRAGAGGLSTCNSPRA
SADSPAPRDPVVPALQEGQAGSVAVTGHTPVPLEAPPAEPEGGLDESGEHFFDAHEVHSD
DNPSEGEGAVKQEEKDVNVLISGNYLILDGYEAVQESSTDEEGAAWLPPQPRTGLPAVDP
AQQQRPSSQKALSDGAVSPFTPEPLAPQRWGALEGACFEIQSPTDSQSRVLECIRKIEAA
LEHLKKVEESYTILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences G1NZV2
ENSMLUP00000003010 ENSMLUP00000003010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]