SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003076 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003076
Domain Number 1 Region: 537-1009
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-135
Family Ras GEF 0.000000000000411
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Histone-fold 6.81e-46
Family TBP-associated factors, TAFs 0.00000118
Further Details:      
 
Domain Number 3 Region: 179-365
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-39
Family DBL homology domain (DH-domain) 0.000000192
Further Details:      
 
Domain Number 4 Region: 388-544
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-38
Family Pleckstrin-homology domain (PH domain) 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003076   Gene: ENSMLUG00000003381   Transcript: ENSMLUT00000003384
Sequence length 1304
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430071:1226724:1292739:1 gene:ENSMLUG00000003381 transcript:ENSMLUT00000003384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVQEQVHPNLSANEESLYYIEELIFQLLNKLCMAQPRTVQDVEERVQKTFPHPIDKWAIA
DAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISADILKLAGNY
VFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVRTEIA
EERQYLRELNMIIKVFREAFLSDKKLFKPSDIEKIFSNISDIHELTIKLLGLIEDTVEMT
DESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPKFNEHFSELMARPAVALHFQSIADG
FREAVRYVLPRLMLVPVYHCWHYFELLKQLKARSEEQEDRECLNQAITALMNLQGSMDRI
YKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPL
TRIGAKHERHIFLFDGLMISCKPNHSQSRLPGYSSAEYRLKEKFVMRKIQICDKEDTSEY
RHAFELVSKDENSIIFSAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLP
SPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTT
YRSFCKPQELLSLLIERFEIPEPEPTEADKLAAEKGEQPISVDLKRFRKEYVQPVQLRIL
NVFRHWVEHHFYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISH
NITFENPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWT
KEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIIEILQVFQDLNNFNG
VLEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHFKKYLVKLKSINPPCVPFF
GIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPEMRRF
FENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGST
SGTLRGHPTPLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDL
NSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKS
DDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFI
NCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPNTPPSTPSPRVPRRCYVLSSSHNNLAHPQ
APPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAETPQ
Download sequence
Identical sequences G1P010
ENSMLUP00000003076 ENSMLUP00000003076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]