SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003307 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003307
Domain Number 1 Region: 564-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-49
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 794-904
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 69-148
Classification Level Classification E-value
Superfamily F-box domain 1.96e-17
Family F-box domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003307   Gene: ENSMLUG00000003634   Transcript: ENSMLUT00000003633
Sequence length 905
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429778:10532537:10588265:-1 gene:ENSMLUG00000003634 transcript:ENSMLUT00000003633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFHTRFSAWTPCSNKALNKQLFQERVALISHWFDLWTTKQRQEFLFTILLRCTKSQLR
FVHDQFSERMKVSKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCIWMP
KCIKLGWFLPYTPTDHEYGAWKHHYIECVCNLDWLTPREAAALYGTLNEPKTDDEELQER
HREKCLRKIIWGEIALRKKELFRARPPWVSGTRCSRLFKSRCQPRLPQTARDRVGLHEAL
EKQLVLASLEALPKRSNVFGKHSYPSLLKKNWRGVLKNDDSTSHAFQTHFILISSRIPAH
EMVVDSVKAGVISVVYEHSGMTLESLLYLTDKALGGQKAQSMGIFTDGDSREINLLQGYK
IGIKNLLRPDVRDFWEKLGSFVAPKEEGGHVDLFVPLGASEAGMEVLSQLSQLTGTLFTA
PAGIATGSYQHILSDWLGQQQERAPPSIYFSESKLQTWSSLMDFLEDTLISVRKQFRPLS
KELPKNASGRIIGQFMSDTMSVTNILNNQEIAQALADGLAALSKENPERNVLEDNPQDTK
PSLGKNDPNVEVLVQLERKLQMDWAAKRTRVAGELLQSERKYVQMLEIVRDVYVAPLRAA
LSSNRAILSAANLQIIFSDILQVLSLNRQFLDNLRDRLQEWGPAHCVGEIFLKFGSQLNT
YTNFFNNYPVVLKTIEKCREMVPAFRAFLKRHDKTIVTKMLSLPELLLYPSRRFDEYVHL
LYALRLHTPAEHADRGDLTTAIDQMKTYKGYIDQMKRNINMKDQLSDIQRIIWGCPILSE
VNRYLIRVQDVAQLHCCDEEISFYLRLYEHTRDLSLFLFNDALLVASRSTSHTPFERTSK
STYQFIASVALHRLLVEDIPDSKYIKNAFILQGPKHEWICATEAEDDKFLWLSVLLNTIK
STMEK
Download sequence
Identical sequences G1P0L8
ENSMLUP00000003307 ENSMLUP00000003307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]