SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003615 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003615
Domain Number 1 Region: 323-427
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-29
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 2 Region: 627-720
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-27
Family SH2 domain 0.00000752
Further Details:      
 
Domain Number 3 Region: 107-262
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-18
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000454
Family SH3-domain 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003615   Gene: ENSMLUG00000003961   Transcript: ENSMLUT00000003969
Sequence length 730
Comment pep:novel scaffold:Myoluc2.0:GL430078:69372:78478:1 gene:ENSMLUG00000003961 transcript:ENSMLUT00000003969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQGLGVAEGSERCPQNVGWIPGL
NERTRQRGDFPGTYVEFLGPVTLARPGPRPRGPRPLPARPQEGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSDSLYRPELPPPCTDWSLSDLEQWDSAALADGIKGFLLA
LPAPLVTLEAAAEACRALRAEAAGPVGPTLEPPTLPLHHALTLRFLLQHLSRVARRAPAP
GPAVRALGVAFGPLLLRAPPPSPPPPGVPPVGTEPNPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKVKPAPAGLANGGSPPSLQDAEWYWGDISREEVNDKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQELRTQALDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEEKGVLSGGQGGLRGCRVSDQRPSLPPLNRTQAEEMLTGKRDGTFLIRESSQRGCYACS
VVVDGDTKHCVIYRTATGLGFAEPYNLYGSLKELVLHYQHTSLVQHNDALTVTLAHPVRA
PGPGPPPATR
Download sequence
Identical sequences G1P1D0
ENSMLUP00000003615 ENSMLUP00000003615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]