SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003954 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003954
Domain Number 1 Region: 386-653
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-76
Family Protein kinases, catalytic subunit 0.000000000303
Further Details:      
 
Domain Number 2 Region: 4-172
Classification Level Classification E-value
Superfamily PH domain-like 7.84e-50
Family Pleckstrin-homology domain (PH domain) 0.0000000405
Further Details:      
 
Domain Number 3 Region: 255-382
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 204-277
Classification Level Classification E-value
Superfamily SH3-domain 8.84e-20
Family SH3-domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003954   Gene: ENSMLUG00000004336   Transcript: ENSMLUT00000004346
Sequence length 663
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429780:676703:700273:1 gene:ENSMLUG00000004336 transcript:ENSMLUT00000004346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVQKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPPFSFRRGEESGEMEQISIIERFPYPFQVVYDEGPLYVFSP
TEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLK
SGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAPVSTSELKKVVALYDYMPMNANDLQLR
KGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEELLK
QEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIP
ELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVV
KYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEY
MANGCLLNYLREMRHHFQNQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVK
VSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKM
PYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPTFKVLLSNILDVMD
EES
Download sequence
Identical sequences G1P273
ENSMLUP00000003954 ENSMLUP00000003954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]