SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004002 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004002
Domain Number 1 Region: 26-149
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-39
Family Phosphotyrosine-binding domain (PTB) 0.0006
Further Details:      
 
Domain Number 2 Region: 447-532
Classification Level Classification E-value
Superfamily SH3-domain 1.24e-17
Family SH3-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004002
Domain Number - Region: 532-585
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0738
Family SAM (sterile alpha motif) domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004002   Gene: ENSMLUG00000004394   Transcript: ENSMLUT00000004398
Sequence length 594
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429868:3310219:3319530:1 gene:ENSMLUG00000004394 transcript:ENSMLUT00000004398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSSKAIYMHRKEYLHSLASEPACPQHRVEHLMTCKLGTQGVREPKDAVQRLQELDAQ
GRVWSQNLLLQVRDGWLQLLDIETKEELDSYRLDSIQAMDAVLNSCSYNSILSITVRGAG
PPGGSTLLFQCPEVGAERLRTSLQKALKEELELRPRFGVPHPGQDRWRGAPLERPLPREQ
AAPLECGPPPEQPPWMAPEHSVPPSPRPLSRHSSAREPSAFALPPPRRPPTPEDPVRDEE
VLNHILRDIEVFVQPLMKAQVNASAKKTKKQGKKKNTGPGGRTPAQYFDCFQKFKYSFNL
LGRLAIHLQNPSAAELLHMLFRTLHLVLTQCPERDLAGQVISPLLTPEAVDMLKFYLSPP
DSNLWKSLGPAWTTSRDNWTGHEVPPYQPMFYDGWQPPEPSNQAPPGYQDSASLRPGSST
LGSTSYLAQVETHHGPPCGAPNLVPFTPRPVQPALRMQVLFEFEARNPKELTVAPGEVVE
VLDHSKRWWLVKDQTGDSGYVPSNILEPLQSGPSGRQSPALRAPMLRLSSRPEEVRAWLQ
AENFTPGTVKALGALTGSQLLHLSPGELQVVCPQDAPRVVARLEASRRTLGISP
Download sequence
Identical sequences G1P2B6
ENSMLUP00000004002 ENSMLUP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]