SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004080 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004080
Domain Number 1 Region: 260-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.000000000102
Further Details:      
 
Domain Number 2 Region: 147-291
Classification Level Classification E-value
Superfamily SH2 domain 3.22e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 65-157
Classification Level Classification E-value
Superfamily SH3-domain 3.47e-25
Family SH3-domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004080   Gene: ENSMLUG00000004480   Transcript: ENSMLUT00000004483
Sequence length 537
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:6811643:6829576:1 gene:ENSMLUG00000004480 transcript:ENSMLUT00000004483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRRSLEPAENAHGGGGGGAFPTSQTPSKPASADGHRGSNTAFSPATA
EPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEG
DWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRE
SETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADG
LCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGK
YLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY
TARQGGQVPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVE
RGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences G1P2J0
ENSMLUP00000004080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]