SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004205 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004205
Domain Number 1 Region: 229-429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-59
Family Protein kinases, catalytic subunit 0.00000061
Further Details:      
 
Domain Number 2 Region: 118-253
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-32
Family SH2 domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 52-141
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000114
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004205   Gene: ENSMLUG00000004616   Transcript: ENSMLUT00000004620
Sequence length 439
Comment pep:known_by_projection scaffold:Myoluc2.0:GL432859:6184:11516:1 gene:ENSMLUG00000004616 transcript:ENSMLUT00000004620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGRARLPVSSLMFNGFDSAKEHPSVNPGFLQAWHSGPSQSGCPHQRRWAPGTQCITKCEH
TRPKPGELAFHKGDMVTILEACESKSWYRAKHHASGQEGLLAAGALREREALSADPKLSL
MPWFHGKISGQEAVQLLQPPEDGLFLVRESVRHPGDYVLCVSFHREVIHYRVLHRDGHLT
IDETICFCNLMDMVEHYSKDKGAICTKLVKPKRKQGAKSAEEELAKAGWLLDLQYLTLGA
QIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKLQHKNLVRLLGVILHQG
LYIVMEHVSKGNLVNFLRTRGRALVNTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNIL
ISEDLVAKVSDFGLVKAERKGLDSSRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFS
YGRAPYPKMVSMAWVGEAL
Download sequence
Identical sequences G1P2V2
ENSMLUP00000004205 ENSMLUP00000004205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]