SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004311 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004311
Domain Number 1 Region: 827-1062
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-56
Family DBL homology domain (DH-domain) 0.0000318
Further Details:      
 
Domain Number 2 Region: 1060-1189
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-32
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 648-699
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004311   Gene: ENSMLUG00000004723   Transcript: ENSMLUT00000004738
Sequence length 1727
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:39799413:39967792:-1 gene:ENSMLUG00000004723 transcript:ENSMLUT00000004738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISCSSCSPNQGQMTVCAKFDKNVYLPKDAEFYFIYNGSHQRHVVIAERTEDNVLQSSIPG
HGLQETVMVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQADRLTASSHQTLLTP
FALTVGALPALDEELVQALTHLELPLGWTVLGHSSLKVTLPRESLLHLAVRWGLPKLSQF
LVCLPGGVQALALPNEEGATPVDLVLNGGHSTLADSITNFQGRRSPGFSRVQLSEDAFLQ
YIHASGTLTLTLHHTAEHLLEADIKLFRKYFWDRAFLIKTLEEQETRPEERSDMPSSAAE
TEEEVKNLVSSRSSPEQEDGKGLKSLVVQLNEHEDQDCLDLDRSCDVLKKSKQPPKFHAA
GGLSDMLNGGDEVYANCMVIDQVGDLDINYINLEGVTTHTCPESMDSTLTPQSGKHILST
ETSPGGHPLDENKEVTSNTEAQQSFTSPSSSCASNLNLSFGLHGFEKEQSHLKKRSSSLD
ALDADSEGEGPAEQAHLCYTPESQGSSRTGIPSGDELDSFETNTEPDFNISRTESLSLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKSRLVRDFTVCNASEEQRAYSLPEPPEEKRIPE
EEWDKYIIPAKSDSEKYKVSRTFSFIMNRMTSPRNKSKTKSKDAKDKEKLSRHQFVPGTA
SGVLQCLVCDKTLLGKESFQCSSCTANVHKGCKDAAPPCPKKFQEKYNKNKPQTILGNSS
FRDVPLAGLSLHPSSSMPIGLPAGRKDTAGQAHPLSRSVPGTILDRRPGTSLESESDGNA
WRSRSHSDELLQSMGSSPSTDSFLMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFCSR
QEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDELLE
IHRHFFYSMKERRQESCADNDRNFVINRIGDILVQQFSEENANTMKKIYGEFCSHHKEAV
SLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKENTE
EHKDLCKALCLIRDMIAAVDLKVSEYEKNQKWLEILSKIENKTYTKLKNGDVFRKQALIS
KERTLLHDGLVFWKTATGRFKEDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQKL
IAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEEGGRTSES
DEERRKAEARVAKIQQCQELLCNQDQQICTYLEEKLHIYAELGELSGFEDVHLEPHLLIK
PDPGEPPQAASLLAAALKEAESLQVAVKASQPGDACQPPEEGCAEAALPDVPSCDAPGPP
TASLVTEGTGGRGCWDVDPGTQGVGADLAVSDAGEKEEYRSFPGSSQSEIIQAIQNLTRL
LYSLQAALTIQDSHIEIHRLLLQPQDSSSPGPSFRGSPFQDPDKHRSLEKQREELADIPK
LQRQFQQDQRRWQRRCDQQRREQEARESWLQERERECQSQEEQLRRSRGELDLQLQEYLQ
NLEQLRVGQRLVERERGRMRAQQSLLGGWKHSRQSSLPAAFSPGSQEVMELNRSESLHYE
NSLFINDALVQMSCNTFDKSTPPAIHQDATCPPSISNSDSERTSENQVDLKTGVSQSTGE
NHELWTAAESCQQTAPLHQSSEDSCQNGSSVKKCSCTRISPWGPCTGSHPPLEDLDISEA
EFPTPPDSNPPGPELQTFIAEAKLNLQTLTRQDGETGDGAEENIVYL
Download sequence
Identical sequences G1P334
ENSMLUP00000004311 ENSMLUP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]